SecReT6
Protein ID: 126447416
SecReT6 ID190
T6SS typei3
Gene symbol-
Locus tagBMA10247_A0455
StrainBurkholderia mallei NCTC 10247
Repliconchromosome II [GenBank: NC_009079] [Browse all T6SS(s) in this replicon]
Location [Strand]399948..400439 [+]
Producthypothetical protein
NoteTssD
UniProt IDA3MBM1
KEGG IDbmn:BMA10247_A0455
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 9.80E-34, Aligned region: 6..138
Protein Sequence: 163 a.a.     [Download]
>gi|126447416|ref|YP_001077657.1| hypothetical protein BMA10247_A0455 [Burkholderia mallei NCTC 10247]
MGVAMFMKVDGVTGESADAQHKGWTDIQSFSWGASQPGAMASGSGGNAGKASFNDLVVAAYMDKGATAII
KNCASGKHLPTVEISACKTGGSQIEFMRVTLQEVLVTSAQIAGVDPGDAADRLMMQYGFQAAKVKKQYWQ
QNDNGGKGAEVSVGWNIKENTEM
 
Nucleotide Sequence: 492 bp     [Download]
>gi|126445587|ref|NC_009079.1|:399948-400439 Burkholderia mallei NCTC 10247 chromosome II, complete sequence
ATGGGCGTCGCAATGTTTATGAAAGTGGACGGCGTCACCGGCGAATCGGCCGACGCGCAGCACAAGGGCT
GGACCGACATCCAGTCGTTCTCATGGGGCGCGAGCCAGCCGGGCGCGATGGCGAGCGGCAGCGGCGGCAA
CGCGGGCAAGGCGAGCTTCAACGATCTCGTCGTCGCCGCGTACATGGACAAGGGCGCAACGGCGATCATC
AAGAACTGCGCGAGCGGCAAGCACCTGCCGACGGTCGAGATATCGGCGTGCAAGACGGGCGGCTCGCAGA
TCGAGTTCATGCGCGTGACGCTGCAGGAAGTGCTCGTCACGTCCGCGCAGATCGCGGGCGTGGACCCGGG
CGACGCGGCCGACCGGCTGATGATGCAGTACGGTTTTCAGGCCGCGAAGGTCAAGAAGCAGTACTGGCAG
CAGAACGACAACGGCGGCAAGGGCGCCGAAGTGTCGGTCGGCTGGAACATCAAGGAGAACACCGAGATGT
GA