SecReT6
Protein ID: 126447482
SecReT6 ID190
T6SS typei3
Gene symbol-
Locus tagBMA10247_A0452
StrainBurkholderia mallei NCTC 10247
Repliconchromosome II [GenBank: NC_009079] [Browse all T6SS(s) in this replicon]
Location [Strand]396667..397746 [+]
ProductImpA-related N-terminal family protein
NoteTssA
UniProt IDA3MBL8
KEGG IDbmn:BMA10247_A0452
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.10E-23, Aligned region: 56..116
Protein Sequence: 359 a.a.     [Download]
>gi|126447482|ref|YP_001077654.1| ImpA-related N-terminal family protein [Burkholderia mallei NCTC 10247]
MQSSDPIESLLAGVAPDAPCGANLEYEQDFLRLQESATPRPEQQYGDTVIPAEAPDWSAVERLALELTAR
TKDLRVAAHLARSWTELRGMPGYADGLRLVAGMLDRWWDDVHPRLDADGDHDPAPRANALAEIAGAHDCA
RAARRQALFDGGPSVRDAERVFDGRDGGEHGYPGGRERLIADLVRARDGGQPTLQAAFAALDALDAIRAR
VASALGGEWVPDASDFEKALRRIVRDGLPPPAAAPAATNGAANVANAAHGGAANGVTNSAANGAASGGAP
AFAANGRAWRDAELTSRDDVQLGLEKMCRYFELHEPSHPAPILLRRAQRLLSLDFYEIIRDLAPESLPKL
DLLSGQRNE
 
Nucleotide Sequence: 1080 bp     [Download]
>gi|126445587|ref|NC_009079.1|:396667-397746 Burkholderia mallei NCTC 10247 chromosome II, complete sequence
ATGCAGAGTTCAGACCCGATCGAATCGTTGCTCGCCGGCGTCGCGCCCGACGCGCCGTGCGGCGCGAATC
TCGAATACGAGCAGGATTTCCTGCGGCTGCAGGAGAGCGCGACGCCGCGGCCCGAACAGCAGTACGGCGA
CACCGTGATCCCGGCCGAAGCGCCGGACTGGAGCGCGGTCGAGCGTCTCGCGCTCGAGCTGACGGCGCGC
ACGAAGGATCTGCGCGTGGCCGCGCATCTCGCGCGCAGTTGGACCGAACTGCGCGGCATGCCCGGCTACG
CGGATGGGCTGAGGCTCGTCGCGGGGATGCTGGACCGGTGGTGGGACGACGTGCACCCGCGCCTGGACGC
CGACGGCGACCACGACCCGGCCCCGCGCGCGAACGCGCTGGCGGAAATCGCGGGCGCGCACGACTGCGCG
CGCGCCGCGCGCCGACAGGCGCTCTTCGATGGCGGCCCGAGCGTGCGCGATGCCGAGCGCGTGTTCGATG
GCCGCGACGGCGGCGAGCACGGCTACCCGGGCGGCCGCGAGCGGCTGATCGCCGATCTGGTTCGCGCGCG
CGACGGCGGGCAGCCGACGCTGCAGGCGGCGTTCGCCGCGCTCGACGCGCTCGATGCGATTCGCGCGCGC
GTCGCATCGGCGCTCGGCGGCGAATGGGTGCCCGACGCGAGCGACTTCGAGAAGGCGCTGCGCCGGATCG
TGCGCGACGGGTTGCCGCCGCCCGCGGCCGCGCCCGCCGCGACAAACGGCGCGGCGAATGTGGCGAATGC
GGCGCACGGCGGCGCGGCAAACGGCGTCACGAACAGTGCCGCGAACGGCGCGGCTTCGGGCGGCGCGCCG
GCTTTCGCCGCGAACGGCCGCGCGTGGCGCGACGCGGAGCTGACGAGCCGCGACGACGTTCAGCTCGGCC
TCGAAAAAATGTGCCGCTACTTCGAGCTGCACGAGCCGAGCCATCCGGCGCCGATCCTGCTGCGCCGCGC
GCAGCGGCTGCTGTCGCTCGACTTCTACGAAATCATCCGGGATCTCGCGCCGGAGAGCCTGCCGAAGCTC
GACTTGCTGAGCGGCCAGCGCAACGAATGA