SecReT6
Protein ID: 126447594
SecReT6 ID193
T6SS typei3
Gene symbol-
Locus tagBMA10247_A2179
StrainBurkholderia mallei NCTC 10247
Repliconchromosome II [GenBank: NC_009079] [Browse all T6SS(s) in this replicon]
Location [Strand]2116792..2117757 [-]
ProductImpE/SciE family protein
NoteTagJ
UniProt IDA3MGG4
KEGG IDbmn:BMA10247_A2179
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 4.60E-51, Aligned region: 149..294
Protein Sequence: 321 a.a.     [Download]
>gi|126447594|ref|YP_001079350.1| ImpE/SciE family protein [Burkholderia mallei NCTC 10247]
MTTPAFPAPPGARTSARPHDTPLDARLAAAQAAVRARPVDAASRWALFQLLCVTGQGERAVGQLQAYARF
AAQHAHIAHAYRDLIRAERFHARVMAGQARPGFVFDAPPWIDDLLEALRAQAAGARDEADRARSRALDRA
PFVAGRGPDAPFDWIADSDSRFGPVCEVVTAGHDRWLPFSDLAGWRLARPGVLLALVWAPCVLTLADGSV
AHGFMPARYPGSELADGGGAPGASAAAHEADAHESAAREADALRLGSRTAWRDVGRTGVFALGRKTWSTS
AGDAGLFELHACEFGARARAGAVLGGAAREARGGEAADGCA
 
Nucleotide Sequence: 966 bp     [Download]
>gi|126445587|ref|NC_009079.1|:c2117757-2116792 Burkholderia mallei NCTC 10247 chromosome II, complete sequence
ATGACGACGCCTGCCTTCCCGGCGCCGCCCGGCGCACGCACGTCGGCCCGGCCGCACGATACGCCGCTCG
ACGCGCGGCTCGCGGCTGCGCAAGCCGCGGTGCGCGCCCGGCCCGTCGATGCGGCGAGCCGTTGGGCGCT
GTTTCAACTGCTCTGCGTGACGGGCCAGGGGGAACGCGCCGTCGGGCAGTTGCAGGCTTATGCGCGGTTC
GCCGCGCAGCACGCGCACATCGCGCACGCCTATCGCGACCTGATTCGCGCCGAGCGCTTTCACGCCCGCG
TGATGGCGGGCCAGGCGCGGCCGGGATTCGTATTCGATGCGCCGCCGTGGATCGACGATCTGCTGGAAGC
GTTGCGCGCGCAGGCGGCCGGCGCGCGCGACGAAGCCGACCGCGCGCGTTCGCGCGCGCTCGATCGCGCG
CCGTTCGTCGCGGGGCGCGGGCCGGATGCGCCGTTCGACTGGATCGCCGACAGCGATTCGCGATTCGGGC
CGGTCTGCGAAGTCGTGACCGCCGGGCATGATCGTTGGCTGCCGTTTTCGGATCTGGCCGGATGGCGGCT
CGCGCGCCCGGGCGTGCTGCTCGCTCTGGTCTGGGCGCCGTGCGTGCTCACGCTTGCCGACGGCAGTGTC
GCGCACGGCTTCATGCCAGCGCGTTACCCGGGCTCCGAACTGGCCGACGGGGGCGGCGCGCCGGGCGCCT
CAGCGGCCGCGCACGAGGCCGATGCGCACGAGAGCGCCGCGCGCGAGGCCGATGCGTTGCGGCTCGGCAG
CCGGACCGCATGGCGCGACGTCGGCCGCACCGGCGTGTTCGCGCTCGGCCGCAAGACCTGGTCGACGAGC
GCGGGCGACGCCGGCCTTTTCGAGCTGCACGCGTGTGAATTCGGCGCGCGCGCCCGTGCGGGCGCCGTGC
TCGGCGGCGCGGCGCGCGAAGCGCGCGGCGGGGAGGCGGCCGATGGATGCGCATGA