SecReT6
Protein ID: 126447767
SecReT6 ID191
T6SS typei1
Gene symbol-
Locus tagBMA10247_A1668
StrainBurkholderia mallei NCTC 10247
Repliconchromosome II [GenBank: NC_009079] [Browse all T6SS(s) in this replicon]
Location [Strand]1605669..1607630 [-]
ProductImpA-related N-terminal family protein
NoteTssA
UniProt IDA3MF15
KEGG IDbmn:BMA10247_A1668
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 5.70E-19, Aligned region: 69..128
Protein Sequence: 653 a.a.     [Download]
>gi|126447767|ref|YP_001078851.1| ImpA-related N-terminal family protein [Burkholderia mallei NCTC 10247]
MGMSERRPPGGAAARARMPIDVQALAVLGRTDIDSAMPAGADVRADARFDALHAELAKLASPGASGQVDW
RAATHLAAELLRERGKDLLVGCYLAGALLQTGGAAGLRCGLEIVGDLVERHWDAMSPPVSRMRARRGALQ
WLVDRVDAMHDAGAAACGGACSAELVAQLRAAARRIDALLAERDDDAPTMRAVHAFAERLPVEVVEVVEV
ADEADVAEAAEAAEAAEAAEAAEAAEAAEAAEAAEAAEAADVADVADVADVADVADVADVAETAEADAHG
STGGPAAEIAIAAAEQALIDPAGRAAPSAGTDTNANADAARQPARLDEAAGRDRALADALAQLHCVATAF
AQADWADARGFRLRRVACWSSVCALPETDAENGRTRIAAPSASIVGAAKNIDEDGEPVAAVRFAEAHAQA
FPLWLDLQRIAARALARAGGDGADARREVETAVRALLARLPGLDALTFADGTPFADDATRAWLGELGAPV
VAADAVSPSSLPLSPRPSPPERSSPMAGEPARAPGDACGASADDAVDRACAFAASGQLDLALHAIQHAID
RATSAEQRLRARVRLCELARDHWPHEVPEAFARGVIEPIRRHDLLAWNPELALDGLSAAYALLIRRDRES
AHARTVLDEIASVDAARAMRLSM
 
Nucleotide Sequence: 1962 bp     [Download]
>gi|126445587|ref|NC_009079.1|:c1607630-1605669 Burkholderia mallei NCTC 10247 chromosome II, complete sequence
ATGGGGATGAGCGAACGGCGCCCGCCCGGCGGCGCGGCGGCGCGCGCGCGCATGCCGATCGATGTCCAAG
CGCTCGCCGTGCTGGGGCGCACGGACATCGATTCCGCCATGCCCGCGGGCGCCGACGTGCGCGCCGACGC
GAGGTTCGACGCGCTGCACGCGGAGCTTGCGAAGCTCGCGTCGCCGGGCGCGAGCGGGCAAGTCGATTGG
CGCGCGGCGACGCATCTCGCCGCCGAATTGCTGCGCGAGCGCGGCAAGGATTTGCTCGTCGGCTGCTATC
TGGCGGGTGCGTTGCTGCAGACGGGCGGCGCGGCGGGGCTGCGCTGCGGACTCGAAATCGTCGGCGATCT
CGTCGAACGTCATTGGGATGCGATGTCGCCGCCCGTGTCGCGGATGCGGGCGAGGCGCGGGGCGCTGCAA
TGGCTGGTCGATCGCGTCGACGCCATGCACGATGCAGGAGCCGCGGCATGCGGCGGCGCGTGCTCGGCCG
AACTGGTCGCGCAATTGCGCGCGGCCGCGCGGCGCATCGATGCGCTGCTCGCCGAGCGCGACGACGACGC
GCCGACGATGCGCGCGGTGCATGCGTTCGCGGAGCGATTGCCTGTTGAGGTGGTTGAGGTGGTGGAAGTG
GCTGACGAGGCTGATGTGGCTGAGGCGGCTGAGGCGGCTGAGGCGGCTGAGGCGGCTGAGGCGGCTGAGG
CGGCTGAGGCGGCTGAGGCGGCTGAGGCGGCTGAGGCGGCTGAGGCGGCTGATGTGGCTGATGTGGCTGA
TGTGGCTGATGTGGCTGATGTGGCTGATGTGGCTGATGTGGCTGAGACGGCCGAGGCCGATGCGCACGGC
TCGACGGGAGGGCCGGCCGCGGAAATCGCGATTGCCGCCGCCGAACAGGCTTTGATTGATCCGGCCGGTC
GAGCCGCGCCGAGCGCCGGCACGGATACGAACGCGAACGCAGACGCCGCCAGGCAACCGGCGCGGCTCGA
CGAAGCGGCCGGCCGCGACCGCGCGCTCGCCGATGCGCTCGCGCAATTGCATTGCGTCGCGACGGCGTTC
GCGCAAGCGGACTGGGCCGACGCGCGCGGCTTCCGGCTGCGCCGCGTCGCGTGCTGGTCGAGCGTGTGTG
CGCTGCCGGAAACGGACGCGGAGAACGGAAGAACGCGGATCGCCGCGCCGAGCGCTTCGATCGTCGGCGC
GGCGAAGAACATCGACGAGGATGGCGAGCCCGTGGCGGCGGTGCGCTTCGCCGAAGCGCATGCGCAGGCG
TTCCCGCTCTGGCTGGATTTGCAGCGCATCGCCGCGCGCGCGCTCGCGCGCGCGGGAGGCGACGGCGCCG
ATGCGCGGCGCGAAGTGGAGACGGCGGTTCGTGCACTGCTTGCGCGGCTGCCGGGCCTCGACGCGCTGAC
GTTCGCGGACGGCACGCCGTTCGCCGACGACGCGACGCGCGCATGGCTCGGCGAGCTTGGCGCGCCTGTT
GTGGCGGCGGATGCGGTGTCGCCGTCGTCTTTGCCGCTTTCGCCGCGACCTTCGCCGCCTGAGCGATCGT
CGCCGATGGCGGGCGAACCGGCGCGCGCGCCGGGCGATGCGTGCGGGGCGAGCGCCGACGATGCAGTGGA
CCGAGCGTGCGCGTTTGCCGCGAGCGGCCAGCTCGATCTCGCGCTCCACGCGATTCAGCATGCGATCGAT
CGTGCGACGAGCGCCGAACAGCGGTTGAGAGCGCGCGTGCGGTTGTGCGAGCTTGCGCGCGACCATTGGC
CGCATGAGGTTCCTGAGGCGTTCGCGCGCGGCGTGATCGAACCGATTCGGCGGCACGATTTGCTCGCATG
GAATCCGGAGCTGGCGCTCGACGGCTTGTCGGCCGCCTATGCGCTGCTGATTCGGCGCGATCGCGAATCG
GCGCACGCGAGGACGGTGCTTGACGAGATCGCGAGCGTCGACGCGGCGCGGGCCATGCGTTTGTCGATGT
GA