SecReT6
Protein ID: 126447950
SecReT6 ID193
T6SS typei3
Gene symbol-
Locus tagBMA10247_A2184
StrainBurkholderia mallei NCTC 10247
Repliconchromosome II [GenBank: NC_009079] [Browse all T6SS(s) in this replicon]
Location [Strand]2122581..2124080 [+]
Producthypothetical protein
NoteTssC
UniProt IDA3MGG9
KEGG IDbmn:BMA10247_A2184
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.30E-191, Aligned region: 67..493
Protein Sequence: 499 a.a.     [Download]
>gi|126447950|ref|YP_001079355.1| hypothetical protein BMA10247_A2184 [Burkholderia mallei NCTC 10247]
MKKQQAQTAAAGVQPQADSDFAQLLAQEFKPKTEQAREAVEYAVRTLAEQALAQSATISDDAYKSIAAII
AQIDHKLSEQINLILHHADFQKLESAWRGLHHLVSNTETDERLKIRFMDISKEELRRTMRRYKGQSWDQS
PLFKQIYEEEYGQLGGEPYGCLVADYYFDHTPPDVDLLGSISKVAASAHTPFLSGASPSVLQMESWQELA
NPRDLTKIFTQNLEYASWNALRNMDDARYIGLAMPRFLSRLPYGVLTNPVDEFDFEEDTNGADHRRYAWT
NAAYAMGVNINRSFRLYGWCSLIRGVESGGTVENLPCHTFPTDDGGIDIKCPTEIAISDRREAELSKNGF
IPLVHRKNTDHATFIGAQSLHKPAEYDDSDATANANLSARLPYLFACSRFAHYLKCIVRDKVGAFKERED
MQRWLNEWIMNYVDADPANSSQDTKARRPLAAAEVVVEQAQGNPGYYQAKFFLRPHFQLEGLTVSLRLVA
KLPSIKEAA
 
Nucleotide Sequence: 1500 bp     [Download]
>gi|126445587|ref|NC_009079.1|:2122581-2124080 Burkholderia mallei NCTC 10247 chromosome II, complete sequence
ATGAAGAAACAGCAAGCCCAGACGGCCGCCGCCGGCGTCCAGCCGCAAGCGGATTCGGATTTCGCGCAGT
TGCTCGCGCAGGAGTTCAAGCCGAAGACGGAGCAGGCGCGCGAAGCGGTCGAATACGCGGTGCGCACGCT
CGCCGAGCAGGCGCTCGCGCAATCGGCGACGATCAGCGACGATGCATACAAGAGCATCGCCGCGATCATC
GCGCAGATCGACCATAAGCTATCCGAACAGATCAACCTGATCCTCCATCACGCGGATTTCCAGAAGCTCG
AATCGGCGTGGCGCGGGCTGCATCACCTGGTGTCGAACACCGAGACCGACGAGCGCCTGAAGATCCGCTT
CATGGACATCTCGAAGGAAGAGCTGCGCCGCACGATGCGGCGCTACAAGGGGCAATCGTGGGACCAGAGC
CCGCTCTTCAAGCAGATCTACGAGGAGGAGTACGGGCAGCTCGGCGGCGAGCCGTACGGCTGCCTCGTCG
CCGATTACTACTTCGACCACACGCCGCCCGACGTCGACCTGCTCGGCTCGATCTCGAAGGTGGCCGCGTC
CGCGCACACGCCGTTCCTCTCCGGCGCGTCGCCTTCGGTGCTGCAGATGGAATCGTGGCAGGAGCTCGCG
AACCCGCGCGACCTGACGAAGATCTTCACGCAAAACCTCGAATACGCGTCATGGAACGCGCTGCGCAACA
TGGACGACGCGCGCTACATCGGCCTCGCGATGCCGCGCTTCCTGTCGCGCCTGCCGTACGGCGTGCTGAC
GAATCCCGTCGACGAGTTCGACTTCGAGGAAGACACGAACGGCGCCGACCATCGCCGCTATGCGTGGACG
AACGCCGCCTACGCGATGGGCGTGAACATCAACCGGTCGTTCCGGCTCTACGGCTGGTGCTCGCTCATTC
GCGGCGTCGAATCGGGCGGCACGGTCGAGAACCTGCCGTGCCATACGTTCCCGACCGACGACGGCGGCAT
CGACATCAAATGCCCAACCGAGATCGCGATCTCGGACCGGCGCGAGGCGGAGCTGTCGAAGAACGGCTTC
ATTCCGCTCGTGCACCGCAAGAACACCGATCACGCGACGTTCATCGGCGCGCAATCGCTGCACAAGCCGG
CCGAATACGACGATTCCGACGCGACGGCCAACGCGAACCTGTCGGCGCGCCTGCCGTATCTGTTCGCATG
CTCGCGCTTCGCGCACTACCTGAAGTGCATCGTGCGCGACAAGGTGGGCGCCTTCAAGGAGCGCGAGGAC
ATGCAGCGCTGGCTGAACGAATGGATCATGAACTACGTCGACGCGGACCCGGCGAACTCGTCGCAGGACA
CGAAGGCGCGCCGGCCGCTCGCGGCCGCCGAGGTGGTCGTCGAGCAGGCGCAGGGCAACCCCGGCTACTA
CCAGGCGAAGTTCTTCCTGCGGCCGCATTTCCAGCTCGAGGGCCTGACCGTGTCGCTGCGGCTCGTCGCG
AAGCTGCCGTCGATCAAGGAAGCCGCCTGA