SecReT6
Protein ID: 126454687
SecReT6 ID184
T6SS typei4b
Gene symbol-
Locus tagBURPS1106A_3655
StrainBurkholderia pseudomallei 1106a
Repliconchromosome I [GenBank: NC_009076] [Browse all T6SS(s) in this replicon]
Location [Strand]3557659..3558759 [-]
Producthypothetical protein
NoteTssG
UniProt IDA3NZW5
KEGG IDbpl:BURPS1106A_3655
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 4.10E-94, Aligned region: 18..347
Protein Sequence: 366 a.a.     [Download]
>gi|126454687|ref|YP_001067886.1| hypothetical protein BURPS1106A_3655 [Burkholderia pseudomallei 1106a]
MQTAQRRIDPGVVERLLDEPHRFEFFQAVRLLETWFAKHDAPRHAASRPGEIVARRIGFRNTLSLGFPPS
EIERAQSYDAAGAALKDDVRRNAALEAGALSRVELTPAFFGLLGGQGALPLHYTEQIIAREQLKRDHAAH
AFFDVFSNRATALFYSAWKKYRLPLHYELDRDERYLPLLLALAGVSNDDARSTVQQGRGALLDEAIAGYA
LAARHRPVSAAYLQRTLSEYFRVPIRVEQFVGKWYDVPPDQLSVLGDVNVTLGATALVGERVWQRDMRAR
LVVGPLTKRDYEAFLPGEERAIALERMLTLLAGVTLEYEVSLVLRRAEVGASVLGAGARLGWDAFLCTRE
AGRDRADARYELHVIH
 
Nucleotide Sequence: 1101 bp     [Download]
>gi|126451443|ref|NC_009076.1|:c3558759-3557659 Burkholderia pseudomallei 1106a chromosome I, complete sequence
ATGCAAACCGCGCAGCGGCGAATCGATCCTGGCGTAGTCGAGCGGCTGCTCGACGAGCCGCATCGCTTCG
AGTTCTTTCAGGCGGTGCGGCTGCTCGAGACCTGGTTCGCGAAGCACGATGCGCCGCGCCACGCGGCGAG
CCGGCCGGGCGAGATCGTCGCGCGGCGCATCGGCTTTCGCAATACGCTGTCGCTCGGCTTTCCGCCGAGC
GAGATCGAGCGCGCGCAGTCGTACGACGCAGCCGGCGCCGCGCTGAAGGACGACGTGCGGCGCAACGCGG
CGCTCGAGGCGGGCGCGCTGTCGCGCGTCGAGCTCACGCCGGCGTTCTTCGGGCTGCTGGGCGGCCAGGG
CGCGCTGCCGCTGCATTACACCGAGCAGATCATCGCGCGTGAGCAACTGAAGCGCGACCATGCCGCGCAC
GCGTTCTTCGATGTCTTCTCGAACCGCGCGACCGCGCTGTTCTATTCGGCATGGAAGAAGTACCGTCTGC
CGCTGCATTACGAACTCGACCGCGACGAGCGCTATCTGCCGCTCCTGCTCGCACTCGCGGGCGTGTCGAA
CGACGACGCGCGCTCGACCGTGCAGCAGGGCCGCGGCGCGCTGCTCGACGAGGCGATCGCGGGCTATGCG
CTCGCCGCGCGGCATCGGCCGGTATCGGCCGCGTATCTGCAGCGCACGCTGTCCGAATATTTTCGCGTGC
CGATCCGCGTCGAGCAGTTCGTCGGCAAGTGGTACGACGTGCCGCCCGATCAATTGAGCGTGCTCGGCGA
CGTGAACGTGACGCTCGGCGCGACGGCGCTCGTCGGCGAGCGCGTGTGGCAGCGCGACATGCGCGCGCGG
CTCGTCGTCGGCCCGCTGACGAAGCGCGACTACGAGGCGTTCCTGCCCGGCGAGGAGCGCGCGATCGCGC
TCGAGCGGATGCTGACGCTGCTCGCGGGCGTGACGCTCGAATACGAGGTGTCGCTCGTGCTGCGCCGCGC
GGAAGTCGGCGCGAGCGTGCTCGGCGCGGGCGCGCGGCTCGGCTGGGACGCGTTTCTCTGCACGCGCGAA
GCCGGGCGCGACCGTGCGGACGCGCGCTACGAGCTGCATGTCATTCATTGA