SecReT6
Protein ID: 126455594
SecReT6 ID188
T6SS typei1
Gene symbol-
Locus tagBURPS1106A_A2025
StrainBurkholderia pseudomallei 1106a
Repliconchromosome II [GenBank: NC_009078] [Browse all T6SS(s) in this replicon]
Location [Strand]1992922..1993416 [+]
Producthypothetical protein
NoteTssB
UniProt IDA3P6U8
KEGG IDbpl:BURPS1106A_A2025
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 5.60E-53, Aligned region: 5..160
Protein Sequence: 164 a.a.     [Download]
>gi|126455594|ref|YP_001076058.1| hypothetical protein BURPS1106A_A2025 [Burkholderia pseudomallei 1106a]
MTTNGSVAPKERVNIVYRPATGDAQAEVELPLKVLVLGEFSTAADKPPLEELSPVNVDKDDFNDVMRAQN
LQLTLSVPNLLDDQAGEDDRLSVTLGFDSVHDFSPDAIVEKVPELKQLIALRDALKALKSPIGNIPGFRR
RIQEIVADKGARKQLLDELGLDEQ
 
Nucleotide Sequence: 495 bp     [Download]
>gi|126455463|ref|NC_009078.1|:1992922-1993416 Burkholderia pseudomallei 1106a chromosome II, complete sequence
ATGACAACGAACGGATCCGTCGCGCCCAAAGAGCGGGTCAACATCGTCTATCGCCCGGCGACGGGCGACG
CGCAGGCGGAGGTCGAGCTGCCGCTCAAGGTGCTCGTGCTCGGCGAGTTCTCGACGGCCGCCGACAAGCC
GCCGCTCGAGGAGCTCTCGCCCGTGAACGTCGACAAGGACGACTTCAACGACGTGATGAGGGCGCAGAAC
CTCCAGCTCACGCTCAGCGTGCCGAACCTGCTGGACGATCAGGCCGGCGAGGACGACCGGCTGTCCGTCA
CGCTCGGCTTCGATTCGGTGCACGATTTCTCGCCCGACGCGATCGTCGAGAAAGTGCCCGAGCTCAAGCA
GCTGATCGCGCTGCGCGACGCGCTGAAAGCGCTGAAGAGCCCGATCGGCAACATTCCCGGCTTTCGCAGG
CGCATCCAGGAGATCGTCGCCGACAAGGGCGCGCGCAAGCAGTTGCTCGACGAACTCGGCCTCGACGAAC
AATGA