SecReT6
Protein ID: 126455750
SecReT6 ID185
T6SS typei3
Gene symbol-
Locus tagBURPS1106A_A0130
StrainBurkholderia pseudomallei 1106a
Repliconchromosome II [GenBank: NC_009078] [Browse all T6SS(s) in this replicon]
Location [Strand]114953..115642 [+]
Producthypothetical protein
NoteTssL
UniProt IDA3P1G3
KEGG IDbpl:BURPS1106A_A0130
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.20E-30, Aligned region: 8..205
Protein Sequence: 229 a.a.     [Download]
>gi|126455750|ref|YP_001074173.1| hypothetical protein BURPS1106A_A0130 [Burkholderia pseudomallei 1106a]
MSIEMPAQPLRMLLQDTMLHVALLTQGARISRVHDWRARCIALVRQFEQALQDGGYRGGIANELGLAQCV
FLDEITMRNLSTEQKEEWLRELLQFRFHSIRDGLSKVRARIDRLCRGHSANAALLEMYSLFHEFGLLGDK
QGHALADARVSEARPTPGKKAVETAEIWKDGGAANEAAHGRSWRIVGGLLAFAALMTMWLVIDTRLSHEV
EQMEVTSGDEAAIHPASGD
 
Nucleotide Sequence: 690 bp     [Download]
>gi|126455463|ref|NC_009078.1|:114953-115642 Burkholderia pseudomallei 1106a chromosome II, complete sequence
ATGTCGATTGAAATGCCCGCGCAGCCGCTGCGCATGTTATTGCAGGACACGATGCTCCATGTCGCGCTAT
TGACGCAAGGCGCGCGCATATCGCGCGTGCATGACTGGCGCGCGCGCTGCATCGCGCTCGTCAGGCAATT
CGAGCAGGCGCTGCAGGACGGCGGCTACCGCGGCGGTATTGCCAATGAATTGGGCCTCGCGCAATGCGTT
TTTCTGGACGAGATCACGATGCGCAATCTGTCGACCGAGCAAAAGGAAGAATGGTTGCGTGAGCTCCTTC
AGTTCCGTTTCCACTCGATTCGGGATGGGTTGAGCAAAGTGCGTGCGCGTATCGATCGCCTTTGCCGCGG
GCATTCGGCGAATGCCGCATTGCTGGAAATGTATTCGTTGTTCCATGAATTCGGTCTCCTGGGAGACAAG
CAAGGACACGCGTTAGCCGACGCGCGGGTGTCAGAGGCAAGGCCGACGCCCGGAAAGAAAGCCGTGGAAA
CGGCGGAGATTTGGAAGGACGGGGGGGCCGCCAATGAAGCGGCGCACGGACGCTCTTGGCGAATCGTCGG
CGGCCTGCTGGCGTTTGCGGCGCTCATGACGATGTGGCTCGTTATCGACACACGTCTGAGCCATGAAGTG
GAACAGATGGAAGTCACGTCCGGAGATGAAGCAGCGATTCATCCGGCATCGGGGGATTGA