SecReT6
Protein ID: 126455771
SecReT6 ID187
T6SS typei3
Gene symbol-
Locus tagBURPS1106A_A0715
StrainBurkholderia pseudomallei 1106a
Repliconchromosome II [GenBank: NC_009078] [Browse all T6SS(s) in this replicon]
Location [Strand]702880..704241 [+]
Producthypothetical protein
NoteTssK
UniProt IDA3P341
KEGG IDbpl:BURPS1106A_A0715
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 8.10E-120, Aligned region: 21..448
Protein Sequence: 453 a.a.     [Download]
>gi|126455771|ref|YP_001074751.1| hypothetical protein BURPS1106A_A0715 [Burkholderia pseudomallei 1106a]
MSSLPVGPVAWSDGMLIETQHFQQLERHLAHQASLRLGQTSNHGWGFTLLDLDQDGLGLGRLGLRHARGV
FQDGTAFSLPSDDPLPPPLETELAQAGDIACLALQAARTGGPEMAFGDVELASRYRAVSTEVPDLAVGLD
APGTPRRLTIETGQLVTRLCWKSQLRSDEVALPIARVAGRNASRTVSLDPRFIPPLLDTRAHLVLRSLID
ELQSTLRVRLASTSAQRVLSTGGGVADLIELLLRQAIAEYRMRLANLDAFDPLPPAMLYHELVGLLGRLS
VLPGVDEELADRELGYDHDDLQTSFEPLAMMLRQALARVIETPVLPLRFEDRGDQVHICIVDKQWNLKKL
IFAFSAAMPAEKLRQLLPQQTKLGAVEQIQKLVDLQLPGARLNALPNPPRQIPYYAQSTYFEVESTDPFW
KQTLAGSAMALRIVGDFPDLRFEAWGLRDGKVA
 
Nucleotide Sequence: 1362 bp     [Download]
>gi|126455463|ref|NC_009078.1|:702880-704241 Burkholderia pseudomallei 1106a chromosome II, complete sequence
ATGAGTAGTCTGCCGGTAGGACCGGTCGCGTGGAGCGACGGCATGCTGATCGAGACGCAGCACTTCCAGC
AGCTCGAGCGGCATCTCGCGCATCAGGCCTCGCTGCGGCTCGGTCAGACGTCGAATCACGGCTGGGGCTT
CACGCTGCTCGATCTCGACCAGGACGGCCTGGGGCTCGGCCGGCTCGGGCTGCGCCACGCGCGCGGCGTG
TTCCAGGACGGCACCGCGTTCTCGCTGCCGTCGGACGATCCGCTGCCGCCGCCGCTGGAAACCGAGCTCG
CGCAGGCGGGCGACATCGCGTGCCTCGCGCTGCAGGCCGCGCGCACGGGCGGCCCGGAGATGGCGTTCGG
CGACGTCGAGCTGGCGTCGCGCTATCGCGCGGTGTCGACCGAGGTGCCGGATCTCGCGGTCGGGCTCGAC
GCGCCCGGCACGCCGCGGCGCCTGACGATCGAGACGGGCCAGCTCGTCACGCGCCTGTGCTGGAAGTCGC
AGCTGCGCTCGGACGAGGTCGCGCTGCCGATCGCGCGCGTGGCGGGGCGCAACGCGAGCCGCACGGTGTC
GCTGGATCCGCGCTTCATTCCGCCGCTGCTCGACACGCGCGCGCACCTGGTGCTGCGCTCGCTGATCGAC
GAGCTGCAGAGCACGCTGCGCGTGCGGCTCGCGAGCACGTCCGCGCAGCGCGTGCTGTCGACGGGCGGGG
GCGTGGCCGATCTGATCGAGCTGCTGCTGCGCCAGGCGATCGCCGAGTACCGGATGCGCTTGGCGAACCT
CGACGCGTTCGATCCGCTGCCGCCGGCGATGCTGTATCACGAGCTGGTCGGCCTGCTCGGGCGGCTGAGC
GTGCTGCCGGGCGTCGACGAGGAACTGGCCGACCGCGAGCTCGGCTACGACCACGACGATCTGCAGACGA
GCTTCGAGCCGCTCGCGATGATGCTGCGCCAGGCGCTCGCGCGCGTGATCGAGACGCCGGTGCTGCCGCT
GCGCTTCGAGGATCGCGGCGATCAGGTGCACATCTGCATCGTCGACAAGCAGTGGAACCTGAAGAAACTG
ATTTTTGCGTTTTCGGCCGCGATGCCGGCGGAGAAGCTGCGGCAACTGTTGCCGCAGCAGACGAAGCTGG
GCGCCGTCGAGCAGATCCAGAAGCTCGTGGACCTGCAACTGCCGGGCGCGCGGCTGAACGCGCTGCCCAA
TCCCCCGCGCCAGATTCCCTACTACGCCCAAAGCACGTACTTCGAAGTGGAATCGACCGATCCGTTCTGG
AAGCAGACCCTCGCCGGCTCGGCGATGGCGCTGCGCATCGTCGGCGATTTCCCCGATCTTCGCTTCGAAG
CCTGGGGGCTGAGAGACGGCAAGGTGGCGTGA