SecReT6
Protein ID: 126455831
SecReT6 ID189
T6SS typei3
Gene symbol-
Locus tagBURPS1106A_A2832
StrainBurkholderia pseudomallei 1106a
Repliconchromosome II [GenBank: NC_009078] [Browse all T6SS(s) in this replicon]
Location [Strand]2776483..2777019 [-]
Producthypothetical protein
NoteTssE
UniProt IDA3P951
KEGG IDbpl:BURPS1106A_A2832
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.80E-22, Aligned region: 42..156
Protein Sequence: 178 a.a.     [Download]
>gi|126455831|ref|YP_001076861.1| hypothetical protein BURPS1106A_A2832 [Burkholderia pseudomallei 1106a]
MRAAGGVRAAHDRLQPALLDRLTDAERERRTEPPDAQAIGGERLRAAVLRDLAWLLNTRNGEDGFVDWSA
FAHAQASVLNYGMRPLVGKPMSGVERMSVEASIRDAIVRFEPRIAPDSVEVRSVLDAPGGAAGERRHNVL
MFEIKGTLWSIPHPVEFVLRSDLDLETGAMALHPAAGG
 
Nucleotide Sequence: 537 bp     [Download]
>gi|126455463|ref|NC_009078.1|:c2777019-2776483 Burkholderia pseudomallei 1106a chromosome II, complete sequence
GTGCGAGCCGCGGGCGGCGTGCGCGCCGCGCATGACCGGCTGCAGCCGGCGCTGCTCGACCGGCTGACCG
ACGCCGAGCGCGAGCGGCGCACCGAGCCGCCCGACGCGCAGGCGATCGGCGGCGAGCGCCTGCGCGCGGC
GGTGCTGCGCGATCTGGCGTGGCTGCTCAACACGCGCAACGGCGAGGACGGCTTCGTCGACTGGTCGGCG
TTCGCGCACGCGCAGGCGTCGGTGCTCAACTACGGGATGCGGCCGCTCGTCGGCAAGCCGATGTCGGGCG
TCGAGCGGATGTCGGTCGAGGCGTCGATCCGCGATGCGATCGTGCGTTTCGAGCCGCGTATCGCGCCCGA
CAGCGTCGAGGTGCGCAGCGTGCTCGACGCGCCGGGCGGCGCGGCGGGCGAGCGCCGGCACAACGTGCTG
ATGTTCGAGATCAAGGGCACGCTGTGGTCGATTCCGCATCCGGTCGAGTTCGTGCTGCGCTCGGACCTCG
ATCTGGAGACGGGCGCGATGGCGCTGCACCCGGCGGCGGGAGGCTGA