SecReT6
Protein ID: 126455835
SecReT6 ID189
T6SS typei3
Gene symbol-
Locus tagBURPS1106A_A2834
StrainBurkholderia pseudomallei 1106a
Repliconchromosome II [GenBank: NC_009078] [Browse all T6SS(s) in this replicon]
Location [Strand]2777601..2779109 [-]
Producthypothetical protein
NoteTssC
UniProt IDA3P953
KEGG IDbpl:BURPS1106A_A2834
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.10E-194, Aligned region: 69..495
Protein Sequence: 502 a.a.     [Download]
>gi|126455835|ref|YP_001076863.1| hypothetical protein BURPS1106A_A2834 [Burkholderia pseudomallei 1106a]
MNERAQTQADTRAAAQPVVARDEFAALLQKEFKPKTAEARESVERAVRTLAQQALEHTVGMTTDAYGSVK
QIIAEIDRKLSEQINLILHHQEFQTLEGAWRGLHYLVTNTETDELLKIKALPASRNELARTLKRYKGVAW
DQSPLFRKVYEEEYGQFGGEPFGCLVGDFHFNHSPPDVEMLGELSKIAAAAHAPFIAGASPELMQMDSWQ
ELANPRDLTKIFQNTEYAAWRSLRQSEDSRYVGLAMPRFLARLPYGARTNPVDEFDFEEDTGAASHDRYT
WANSAYAMAANINRSFKLYGWCSSIRGVESGGAVQGLPCHTFPTDDGGVDQKCPTEIAISDRREAELAKN
GFMPFVHRKNSDFAAFIGAQSLYQPAEYHDPDATANARLSGRLPYLFACCRFAHYLKCIVRDKIGSFRER
DDMERWLNDWIMNYVDGDPANSSQETKARKPLAAAQVVVEEIDDNPGYYASKFFLRPHYQLEGLTVSLRL
ISKLPSAKAAGE
 
Nucleotide Sequence: 1509 bp     [Download]
>gi|126455463|ref|NC_009078.1|:c2779109-2777601 Burkholderia pseudomallei 1106a chromosome II, complete sequence
ATGAATGAACGTGCCCAAACCCAGGCCGACACGCGCGCCGCCGCCCAGCCCGTGGTCGCGCGCGACGAGT
TCGCCGCGCTGCTGCAAAAGGAGTTCAAGCCGAAGACGGCGGAGGCGCGCGAATCGGTCGAGCGCGCGGT
GCGCACGCTCGCGCAGCAGGCGCTCGAGCACACGGTCGGCATGACGACCGACGCTTACGGCAGCGTCAAG
CAGATCATCGCCGAGATCGACCGCAAGCTCTCCGAGCAGATCAACCTGATCCTGCATCATCAGGAGTTCC
AGACGCTCGAAGGCGCGTGGCGCGGCCTGCACTACCTCGTCACGAACACCGAGACCGACGAGCTGCTGAA
GATCAAGGCACTGCCCGCGTCGCGCAACGAGCTCGCGCGCACGCTCAAGCGCTACAAGGGCGTCGCGTGG
GATCAGAGCCCGCTGTTTCGCAAGGTCTACGAAGAAGAGTACGGCCAGTTCGGCGGCGAGCCGTTCGGCT
GCCTCGTCGGCGATTTCCATTTCAACCACAGTCCGCCCGACGTCGAGATGCTCGGCGAGCTGTCGAAGAT
CGCGGCGGCCGCGCATGCGCCGTTCATCGCGGGCGCGTCGCCCGAGCTGATGCAGATGGATTCGTGGCAG
GAGCTCGCCAATCCGCGTGATCTGACGAAGATCTTCCAGAACACCGAATACGCCGCGTGGCGCAGCTTGC
GCCAGTCCGAGGATTCGCGCTACGTCGGGCTCGCGATGCCGCGCTTTCTCGCGCGGCTGCCGTACGGCGC
GCGCACGAATCCCGTCGACGAATTCGACTTCGAGGAGGATACCGGCGCCGCGAGCCACGACCGCTACACG
TGGGCGAATTCCGCGTACGCGATGGCGGCGAACATCAACCGCTCGTTCAAGCTGTACGGCTGGTGCTCGT
CGATCCGCGGCGTCGAATCGGGCGGCGCGGTGCAAGGGCTGCCGTGCCACACGTTCCCCACCGACGACGG
CGGCGTCGACCAGAAATGCCCGACCGAGATCGCGATCAGCGACCGCCGCGAGGCCGAGCTCGCGAAGAAC
GGCTTCATGCCGTTCGTACATCGAAAGAATTCGGATTTCGCGGCGTTCATCGGCGCGCAGTCGCTGTATC
AGCCCGCCGAGTATCACGATCCCGACGCGACCGCGAACGCGCGGCTCTCGGGCCGCCTGCCGTACCTGTT
CGCGTGCTGCCGCTTCGCGCATTACCTGAAGTGCATCGTGCGCGACAAGATCGGCTCGTTTCGCGAGCGC
GACGACATGGAGCGCTGGCTCAACGACTGGATCATGAACTACGTCGACGGCGATCCGGCGAACTCGTCGC
AGGAGACGAAGGCGCGCAAGCCGCTCGCGGCCGCGCAGGTCGTCGTCGAGGAGATCGACGACAACCCCGG
CTATTACGCGTCGAAATTCTTCCTGCGGCCGCATTACCAGCTGGAAGGGCTCACCGTGTCGCTGCGGCTC
ATCTCGAAGCTGCCGTCGGCGAAGGCGGCGGGCGAATGA