SecReT6
Protein ID: 126456040
SecReT6 ID187
T6SS typei3
Gene symbol-
Locus tagBURPS1106A_A0703
StrainBurkholderia pseudomallei 1106a
Repliconchromosome II [GenBank: NC_009078] [Browse all T6SS(s) in this replicon]
Location [Strand]686941..687372 [+]
Producthypothetical protein
NoteTssE
UniProt IDA3P329
KEGG IDbpl:BURPS1106A_A0703
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 4.40E-11, Aligned region: 15..116
Protein Sequence: 143 a.a.     [Download]
>gi|126456040|ref|YP_001074739.1| hypothetical protein BURPS1106A_A0703 [Burkholderia pseudomallei 1106a]
MSDLQLYNKLSKRIRRHSLQEVVADHLVDLMNHAIRGARMRIADDSPAAHSVLNFGCPPMQMAGATKINP
VHAAAHICEVIRRFEPRVDPASTVVKPRTESRKRLAQTIYFDVSMKAREDGAELRASLALDYLSGYFSLA
DDR
 
Nucleotide Sequence: 432 bp     [Download]
>gi|126455463|ref|NC_009078.1|:686941-687372 Burkholderia pseudomallei 1106a chromosome II, complete sequence
GTGAGCGATCTTCAACTCTACAACAAGCTGTCGAAACGGATTCGTCGCCATTCGCTGCAAGAGGTCGTGG
CCGACCACTTGGTCGATCTGATGAATCACGCGATCCGCGGTGCGCGCATGCGCATCGCGGACGACAGCCC
GGCCGCGCATTCGGTGCTGAACTTCGGTTGTCCGCCGATGCAGATGGCCGGTGCGACGAAGATCAATCCG
GTTCATGCGGCCGCGCATATCTGCGAGGTGATTCGCCGCTTCGAGCCGCGCGTGGACCCTGCCAGCACGG
TGGTCAAGCCGCGCACGGAGAGCCGCAAGCGCCTCGCGCAGACGATTTATTTCGACGTGTCGATGAAGGC
GCGCGAAGACGGAGCCGAACTCAGGGCGAGCCTCGCGCTCGACTATCTGAGTGGTTATTTCAGCCTGGCG
GACGACCGATGA