SecReT6
Protein ID: 126456151
SecReT6 ID188
T6SS typei1
Gene symbol-
Locus tagBURPS1106A_A2037
StrainBurkholderia pseudomallei 1106a
Repliconchromosome II [GenBank: NC_009078] [Browse all T6SS(s) in this replicon]
Location [Strand]2009928..2010725 [+]
Producthypothetical protein
NoteTssJ
UniProt IDA3P6W0
KEGG IDbpl:BURPS1106A_A2037
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.50E-25, Aligned region: 46..208
Protein Sequence: 265 a.a.     [Download]
>gi|126456151|ref|YP_001076070.1| hypothetical protein BURPS1106A_A2037 [Burkholderia pseudomallei 1106a]
MNARHIAPPAATRARRPMQPGRPSWPSRTYRACAARTCAAVLVALAALAGCAARVTEEQARADVRWDYAP
DALRIDIDASARLNEYLNAPHTLLLAVFQSADAKAFRQLADDPDRLRMTLAAGGPAADFIQTTRYVVAPG
QHVALSIDRAQQARYVGIVAGYYDADGPRAARLFEVPLRIDKRGWFSSTYRAAPRTLELKLRLGAQSITD
AREAPLNLPPPGARAWTALDSGAKTLALPSADANDGGSGKRDKRGNAAARAPRKQ
 
Nucleotide Sequence: 798 bp     [Download]
>gi|126455463|ref|NC_009078.1|:2009928-2010725 Burkholderia pseudomallei 1106a chromosome II, complete sequence
ATGAACGCACGACACATTGCCCCGCCGGCCGCGACGCGCGCGCGCCGGCCGATGCAGCCCGGCCGGCCGT
CATGGCCGTCGCGAACGTATCGCGCATGCGCGGCTCGCACATGCGCTGCCGTGCTCGTCGCGCTCGCCGC
CCTCGCCGGCTGTGCGGCCCGCGTCACCGAAGAGCAGGCGCGCGCCGACGTGCGATGGGACTACGCGCCC
GACGCGCTGCGCATCGATATCGACGCGTCGGCGCGGTTGAACGAATACCTGAACGCGCCGCACACGCTGT
TGCTCGCGGTGTTCCAGAGCGCGGACGCGAAGGCGTTCCGCCAGCTCGCCGACGATCCGGACCGGCTGCG
CATGACGCTCGCGGCGGGCGGCCCCGCCGCGGACTTCATTCAGACGACCCGCTACGTCGTCGCGCCCGGC
CAGCATGTCGCGCTGTCGATCGATCGCGCGCAGCAGGCGCGCTACGTCGGCATCGTCGCCGGCTACTACG
ACGCCGACGGCCCACGCGCGGCGCGCCTGTTCGAGGTGCCGCTGCGCATCGACAAGCGCGGCTGGTTCTC
CTCCACCTATCGCGCCGCGCCGCGAACGCTCGAGCTGAAGCTCAGGCTCGGCGCGCAGAGCATCACCGAC
GCGCGCGAAGCGCCGCTGAACCTGCCGCCGCCGGGCGCGCGCGCATGGACGGCGCTCGACAGCGGCGCGA
AGACCCTGGCGCTGCCGAGCGCCGACGCGAACGACGGCGGCAGCGGCAAGCGCGACAAACGCGGCAACGC
CGCCGCCCGTGCGCCGCGCAAGCAATGA