SecReT6
Protein ID: 126456197
SecReT6 ID185
T6SS typei3
Gene symbol-
Locus tagBURPS1106A_A0150
StrainBurkholderia pseudomallei 1106a
Repliconchromosome II [GenBank: NC_009078] [Browse all T6SS(s) in this replicon]
Location [Strand]139569..141449 [-]
Producthypothetical protein
NoteTssF
UniProt IDA3P1I3
KEGG IDbpl:BURPS1106A_A0150
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 7.90E-211, Aligned region: 5..624
Protein Sequence: 626 a.a.     [Download]
>gi|126456197|ref|YP_001074193.1| hypothetical protein BURPS1106A_A0150 [Burkholderia pseudomallei 1106a]
MDPQFLDHYNRELTYMRELSAEFAAQHPKIARRLGMQGIEVADPYVERLIEAFCFMSARTQLKLEAEFPR
FTQRLLEVAYPNYVAPTPSMAVARLRPSLREGDFSKGFKVPRHSMLRSSIPPGEQTACEFRTGQDITLWP
IEIAGATLTAVPPDLPDLQRSLLPHTKLRGALRLRVRTVGEIRFSQITGLDRLSLYIGGDERIASHLFEL
IHASSVASVVRAPGAARGEGAVVAKNAVDFEGLSPDQSLLPLVWNTFHGHNLLHEYFTCRQRFYFFALTQ
LNAGLSRIDGKEAEIVLLLDRLPDELVTHVEAARFLLFCAPIVNLFPKRTDRVEINRAQTAFHLIPDRTR
PLDYEVFSVSRVFGQKAETSTEVTFNPLYQTLHSDIGNYGRYFSILREPRTTSTNARKYGTRTPYVGTEV
YVSLVDQAEAPYADDIRYLSVDAWVTNRDLPRLIPRNGVNDLTMQDSVPIEGVSLVHPPSAPREPYATGE
TAWRLIRQLSFNYMPLAELDHRDGGQALRNMLRLFVGTSEREQATQIDSLVGARTEPVVRRLPGHGLLVY
GRGVRCELTVDESGFSGLSPYLFGLVLEQYLTRHVSINVFTETELRSMQRGLVTRWKPRMGGRGAV
 
Nucleotide Sequence: 1881 bp     [Download]
>gi|126455463|ref|NC_009078.1|:c141449-139569 Burkholderia pseudomallei 1106a chromosome II, complete sequence
ATGGACCCGCAGTTTCTCGATCACTACAACCGCGAATTGACCTACATGCGGGAGTTGTCCGCGGAATTCG
CGGCGCAACACCCGAAGATCGCGCGCCGACTCGGCATGCAAGGCATCGAAGTGGCGGACCCGTACGTAGA
ACGGCTCATCGAGGCGTTCTGCTTCATGTCCGCGCGCACGCAACTCAAGCTCGAGGCCGAGTTCCCCCGC
TTCACGCAACGCCTGCTCGAAGTCGCCTATCCGAATTACGTCGCGCCGACGCCGTCGATGGCCGTCGCGC
GCCTGCGTCCAAGCCTGCGGGAAGGCGACTTCAGCAAGGGGTTCAAGGTTCCGCGTCACAGCATGCTGCG
CTCGTCGATCCCGCCCGGCGAGCAGACCGCATGCGAATTCCGCACCGGCCAGGACATCACGCTCTGGCCC
ATCGAGATCGCCGGCGCGACGCTGACCGCCGTGCCGCCCGATCTTCCGGATCTTCAGCGCAGCCTGCTGC
CGCACACGAAGCTGCGCGGCGCACTCCGGCTGCGCGTGCGCACCGTCGGCGAAATCAGGTTTTCGCAAAT
TACCGGGCTCGATCGCCTCTCGCTGTATATCGGCGGCGACGAACGCATCGCCTCCCATCTTTTCGAGCTG
ATTCACGCGAGCAGCGTCGCGTCGGTCGTGCGCGCGCCGGGCGCCGCGCGCGGCGAAGGCGCCGTCGTCG
CGAAGAATGCGGTCGACTTCGAAGGCCTGTCGCCCGATCAAAGCCTGTTGCCGCTCGTCTGGAATACGTT
CCACGGGCACAATCTGCTGCACGAATACTTCACCTGCCGTCAGCGCTTCTATTTCTTCGCGCTCACGCAA
TTGAACGCCGGCTTGTCGCGCATCGACGGAAAGGAAGCCGAAATCGTGCTGTTGCTCGACCGCTTGCCCG
ACGAGCTCGTCACGCACGTCGAGGCCGCGCGCTTTCTGCTGTTTTGCGCCCCCATCGTCAATCTGTTCCC
GAAGCGGACCGACCGGGTGGAAATCAATCGCGCCCAAACGGCTTTCCACCTGATACCGGACCGCACCCGC
CCGCTCGATTACGAAGTATTCTCGGTGTCGCGCGTGTTCGGGCAAAAAGCCGAGACGTCGACGGAAGTCA
CGTTCAATCCGCTCTATCAGACGCTGCATAGCGACATCGGCAATTACGGCCGGTATTTCTCGATCCTGCG
CGAACCCAGAACGACATCGACCAACGCACGCAAGTATGGAACGCGCACGCCATACGTCGGAACGGAAGTC
TACGTGTCGCTCGTCGACCAGGCCGAAGCGCCGTACGCCGACGACATTCGTTACCTGTCCGTCGACGCAT
GGGTCACCAACCGCGATCTGCCCCGACTGATCCCGCGCAACGGCGTCAACGATCTGACGATGCAAGACTC
CGTGCCGATCGAGGGCGTGAGCCTCGTCCATCCGCCGAGCGCGCCGCGCGAGCCGTACGCGACCGGCGAA
ACCGCGTGGCGGCTGATTCGCCAGCTCAGCTTCAACTACATGCCGCTTGCCGAGCTCGACCACCGCGACG
GCGGGCAAGCACTGCGCAACATGCTGCGCCTCTTCGTCGGCACGAGCGAGCGCGAACAGGCCACGCAGAT
CGACAGCCTGGTCGGCGCGCGCACGGAGCCTGTCGTCCGCCGTCTGCCCGGCCACGGATTACTGGTTTAC
GGGCGCGGCGTCCGGTGCGAGCTGACCGTCGACGAAAGCGGCTTCTCCGGGTTGAGTCCATACCTGTTCG
GTCTCGTGCTCGAGCAATACCTCACGCGCCACGTCTCGATCAATGTGTTCACCGAGACGGAGCTTCGCTC
GATGCAACGCGGCCTCGTCACGCGCTGGAAACCGCGCATGGGCGGAAGGGGCGCGGTATGA