SecReT6
Protein ID: 126456359
SecReT6 ID185
T6SS typei3
Gene symbol-
Locus tagBURPS1106A_A0148
StrainBurkholderia pseudomallei 1106a
Repliconchromosome II [GenBank: NC_009078] [Browse all T6SS(s) in this replicon]
Location [Strand]137434..138504 [-]
ProductImpA-related N-terminal family protein
NoteTssA
UniProt IDA3P1I1
KEGG IDbpl:BURPS1106A_A0148
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 8.10E-22, Aligned region: 61..120
ImpA-rel_N [PF06812], Evalue: 8.10E-22, Aligned region: 184..193
Protein Sequence: 356 a.a.     [Download]
>gi|126456359|ref|YP_001074191.1| ImpA-related N-terminal family protein [Burkholderia pseudomallei 1106a]
MNATPPAAALRYADLLEPVSPDAPCGPDLEYDPAFVMLQSAIAPRKDAQYGEFVEAPQPANWAEAERDCL
ALLLRTKDIRLVVILMRCRIRQSGAEGLRDGLTLLNELLARYGEALHPVPFFEGERDPVVYANAIATLAD
PDATLADIREIPLPKASGLQLQLRDIEKALAVTRVKDALAPESASRLLKEWWNRRDKTIAALAQAQRIVA
DLIASTRESLGDDAPDLSGIAKLLHPFAQAQLESPYSANAAQPQGDAKPATGDAAHARAADTSAQAGDTD
TQAPAAMPIAPAQPPMDRWGALAAIQATRLWFEQNEPSSPVIVLLRQSERMVGKRFSEIANAIPAELLAQ
WDAIDV
 
Nucleotide Sequence: 1071 bp     [Download]
>gi|126455463|ref|NC_009078.1|:c138504-137434 Burkholderia pseudomallei 1106a chromosome II, complete sequence
ATGAATGCCACCCCACCCGCCGCCGCGCTGCGCTATGCGGATCTTCTCGAGCCCGTCTCGCCGGACGCAC
CCTGCGGGCCGGACCTCGAATACGATCCGGCGTTCGTGATGCTGCAATCCGCGATCGCGCCGAGGAAAGA
TGCGCAATATGGCGAGTTCGTCGAAGCGCCTCAGCCCGCGAACTGGGCGGAGGCCGAACGCGATTGCCTC
GCGCTGCTGCTGCGCACGAAAGACATCCGGCTCGTCGTGATCCTGATGCGATGCCGAATCCGCCAGAGCG
GCGCGGAGGGCCTGCGCGACGGCCTCACGCTGCTCAACGAGTTGCTCGCACGCTACGGTGAGGCACTGCA
CCCCGTACCGTTCTTCGAAGGCGAACGCGATCCCGTGGTCTATGCGAATGCGATCGCCACGCTGGCGGAC
CCCGATGCGACGCTCGCGGATATTCGGGAAATCCCGTTGCCCAAGGCGAGCGGCCTGCAATTGCAGTTGC
GCGACATCGAAAAGGCGCTCGCGGTGACGCGCGTGAAAGACGCACTCGCGCCCGAATCGGCCAGCCGGCT
GCTGAAGGAATGGTGGAATCGGCGCGACAAGACGATCGCGGCGCTCGCGCAAGCCCAGCGCATCGTGGCC
GATCTGATCGCGTCGACCCGCGAGTCGCTCGGCGACGACGCGCCCGACCTGTCCGGCATCGCGAAACTGC
TGCATCCGTTTGCGCAAGCGCAACTGGAATCGCCGTATTCGGCAAACGCCGCTCAACCGCAAGGCGACGC
GAAGCCGGCGACCGGCGACGCCGCGCATGCGCGCGCCGCCGATACGTCCGCCCAGGCAGGCGATACCGAC
ACGCAAGCGCCCGCTGCGATGCCGATCGCGCCTGCCCAACCGCCGATGGATCGCTGGGGCGCGCTGGCGG
CCATTCAGGCGACGCGCCTTTGGTTCGAGCAGAACGAGCCGAGCAGCCCGGTGATCGTGCTGCTGCGCCA
GTCGGAGCGGATGGTCGGCAAGCGCTTTTCGGAAATCGCCAATGCGATTCCCGCCGAACTGCTCGCGCAA
TGGGATGCGATCGACGTCTAG