SecReT6
Protein ID: 126456440
SecReT6 ID187
T6SS typei3
Gene symbol-
Locus tagBURPS1106A_A0707
StrainBurkholderia pseudomallei 1106a
Repliconchromosome II [GenBank: NC_009078] [Browse all T6SS(s) in this replicon]
Location [Strand]693098..695389 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDA3P333
KEGG IDbpl:BURPS1106A_A0707
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 8.70E-71, Aligned region: 23..328
Phage_GPD [PF05954], Evalue: 8.70E-71, Aligned region: 691..717
Phage_base_V [PF04717], Evalue: 3.60E-23, Aligned region: 366..459
Protein Sequence: 763 a.a.     [Download]
>gi|126456440|ref|YP_001074743.1| Rhs element Vgr protein [Burkholderia pseudomallei 1106a]
MRLIELRSPLLDPDAVALSFVVHENLSQEPSYQLDLLSHDPDLDFDALLGSTLSADIDLGEGDIRTFNTH
VFGGYDTGQMSGQYTYTLELRSWLSFLAENRNSRIFQNMSVPQIVEQVFQGHQRNGYRFELEGTYEPREY
CVQFQETDLNFVKRLLEDEGIYFWVEHEPDRHVVVISDTQRFEDLPLPNDTLEYLPDGEESRAIQGREGV
QRLQRTRRIKSNNVALRDFDYHAPSNKLDSDAQQVSPPNLEGIPLEYYDYAAGYREPEQGERLARLRLEA
IQAESHTLVGEANARALATGRAFTLIGHPALGRNRRYYVTNSELTFIQDGPDSTSQGRNVAVKFRALVDD
QPFRPLLTTPRPEVPGIQSATVVGPEMSEVHTDKLGRIRVHFHWDRYKTTEADASCWIRVSQAWAGKGWG
VIAMPRVGQEVLVTYVDGDLDRPLVTGIVYNGENPTPYDLPKDIRYTGLVSRSIKRAGGYQNASQITFDD
QRGAERVMIHAERDMQQTVERNSSTSIAQDLNLSVKGTSTSVVGISISFTGISVSYTGLSVSFTGVSASF
TGVSTSFTGVSTSFTGVSTSFTGVDTGFKGVSTSFTGVDTSFKGVSTSFTGVSTSLTGSSNSVTGVSNSM
TGISSSWTDVSMSTTGQSQSITGVSLSYTGTSNSMTGTSTSVTGTSTSITGTSMSNTGSSTSITGTSMST
TGSSTSVTGSSVSTTGSSVSTTGSSVSTTGSSVSTTGFSFSYTGVSYSDTGIDLKKVGMQVKS
 
Nucleotide Sequence: 2292 bp     [Download]
>gi|126455463|ref|NC_009078.1|:693098-695389 Burkholderia pseudomallei 1106a chromosome II, complete sequence
ATGCGTCTGATCGAACTGCGCAGTCCCCTGCTGGACCCGGATGCGGTGGCGCTGAGCTTCGTGGTGCACG
AGAACCTGTCGCAGGAGCCGTCGTATCAACTGGATCTGCTGAGCCACGATCCGGATCTGGACTTCGACGC
GCTGCTCGGCTCGACGCTGTCGGCCGACATCGACCTGGGCGAAGGCGACATCCGGACGTTCAACACGCAC
GTGTTCGGCGGCTACGACACGGGGCAGATGAGCGGGCAATACACGTACACGCTGGAGCTGCGAAGCTGGC
TGTCGTTTCTCGCGGAGAACCGCAACAGCCGGATCTTCCAGAACATGAGCGTGCCGCAGATCGTCGAGCA
GGTGTTCCAGGGCCATCAGCGCAACGGCTACCGGTTCGAGCTCGAAGGCACGTACGAGCCGCGCGAGTAC
TGCGTGCAGTTCCAGGAAACGGATCTGAACTTCGTGAAGCGGCTGCTGGAGGACGAAGGGATCTACTTCT
GGGTGGAGCACGAGCCGGATCGTCATGTGGTGGTGATCTCGGACACGCAGCGGTTCGAGGATCTGCCGCT
GCCGAACGACACGCTGGAGTATCTGCCGGACGGCGAGGAGTCGCGCGCGATCCAGGGGCGCGAAGGGGTG
CAGCGGCTGCAGCGCACGCGGCGGATCAAGTCGAACAACGTCGCGCTGCGGGATTTCGACTATCACGCGC
CGTCGAACAAGCTCGATAGCGACGCGCAGCAGGTGTCGCCGCCGAACCTCGAAGGGATTCCGCTCGAGTA
TTACGACTATGCGGCGGGCTACCGCGAGCCCGAGCAGGGCGAGCGTCTCGCGCGGCTGCGGCTCGAGGCG
ATTCAGGCGGAGTCACACACGCTGGTGGGCGAGGCGAACGCGCGCGCGCTGGCCACGGGCCGGGCGTTCA
CGTTGATCGGGCATCCGGCGCTGGGGCGCAATCGTCGGTACTACGTGACGAACAGCGAGCTGACGTTCAT
CCAGGACGGACCGGACAGCACGTCGCAGGGGCGCAACGTCGCGGTGAAGTTCCGCGCGCTTGTCGACGAT
CAGCCGTTTCGGCCGCTGTTGACGACGCCGCGTCCCGAAGTGCCGGGCATCCAGAGCGCGACGGTGGTGG
GTCCGGAGATGTCGGAAGTGCATACCGACAAGCTCGGGCGGATTCGCGTGCATTTCCATTGGGACCGCTA
CAAGACGACCGAGGCGGATGCGTCGTGCTGGATACGCGTGTCGCAGGCATGGGCGGGCAAGGGCTGGGGC
GTGATCGCGATGCCGCGGGTCGGGCAGGAAGTGCTCGTCACGTATGTCGACGGCGATCTCGATCGGCCGC
TCGTGACGGGCATCGTCTACAACGGCGAGAACCCGACGCCTTATGACTTGCCGAAGGACATCCGCTACAC
GGGGCTGGTGTCGCGTTCGATCAAGCGTGCGGGCGGTTATCAGAACGCGAGTCAGATCACGTTCGATGAC
CAGCGCGGCGCGGAGCGCGTGATGATCCACGCGGAGCGCGACATGCAGCAGACGGTCGAGCGCAACAGCT
CGACGTCGATCGCGCAGGATTTGAACCTGTCGGTGAAGGGCACGTCGACGTCGGTCGTCGGCATCTCGAT
CAGCTTCACGGGCATCTCGGTGTCGTACACGGGGTTGTCGGTGAGCTTCACCGGCGTGTCGGCGAGCTTC
ACGGGCGTGAGCACGTCGTTTACCGGCGTGAGCACGAGTTTCACCGGCGTGTCGACGTCGTTTACCGGCG
TCGACACCGGCTTCAAGGGCGTGTCGACGTCGTTTACCGGCGTCGATACCAGCTTCAAGGGTGTGTCGAC
TTCGTTCACGGGCGTAAGCACGAGCCTCACCGGTTCGAGCAACTCGGTGACGGGCGTGTCGAACAGCATG
ACGGGCATCTCGTCATCATGGACCGACGTCAGCATGTCGACGACCGGCCAATCCCAAAGCATCACGGGGG
TATCGCTGTCGTACACGGGCACGTCGAACAGCATGACGGGCACGAGCACGTCGGTGACGGGCACCTCGAC
GAGCATCACCGGCACGTCGATGTCGAACACCGGCAGCTCGACGAGCATCACGGGCACGTCGATGTCGACG
ACGGGCAGCTCGACGAGCGTCACCGGCTCGAGCGTATCGACGACCGGCAGCTCGGTGAGCACGACGGGCT
CGAGCGTGTCGACAACGGGCAGCAGCGTGTCGACGACAGGTTTCAGCTTCTCGTACACCGGCGTCAGTTA
TTCGGACACCGGTATTGACCTGAAGAAGGTCGGCATGCAAGTGAAGAGCTGA