SecReT6
Protein ID: 126456559
SecReT6 ID185
T6SS typei3
Gene symbolsciN
Locus tagBURPS1106A_A0137
StrainBurkholderia pseudomallei 1106a
Repliconchromosome II [GenBank: NC_009078] [Browse all T6SS(s) in this replicon]
Location [Strand]120593..121135 [+]
ProductSciN protein
NoteTssJ
UniProt IDA3P1H0
KEGG IDbpl:BURPS1106A_A0137
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.10E-36, Aligned region: 26..174
Protein Sequence: 180 a.a.     [Download]
>gi|126456559|ref|YP_001074180.1| SciN protein [Burkholderia pseudomallei 1106a]
MAFPFFFRREAARRTAVKRVVAAMVCASLAACASLPARKETADLIVKIKVSEGANPDEHQRPAPVMVRLY
ELKSAGAFENADFFTLQSDSRKVLGDDAIATDEFVMRPGDTRDIHRRADSAGTSVGVLVGYRELGKSVWR
AVHKLRPAPEDAWYRAFTPRTKIKLNVDVGQQTVTITELE
 
Nucleotide Sequence: 543 bp     [Download]
>gi|126455463|ref|NC_009078.1|:120593-121135 Burkholderia pseudomallei 1106a chromosome II, complete sequence
ATGGCTTTCCCATTTTTCTTTCGCCGCGAAGCGGCCAGGCGAACCGCCGTCAAGCGCGTTGTGGCGGCAA
TGGTATGCGCATCGCTCGCGGCTTGCGCAAGCTTGCCGGCACGCAAGGAAACAGCCGATCTGATCGTGAA
GATCAAGGTGAGCGAAGGCGCCAATCCGGATGAGCATCAGCGCCCGGCGCCCGTGATGGTGCGGCTGTAC
GAGCTGAAATCGGCCGGCGCGTTCGAGAACGCCGATTTTTTCACGCTACAGAGCGACAGCCGCAAGGTGT
TGGGTGACGACGCGATCGCGACGGATGAATTCGTGATGCGCCCGGGCGACACCCGGGATATTCATCGGCG
TGCCGATTCCGCGGGGACGTCGGTCGGCGTGCTGGTCGGTTATCGAGAGCTCGGCAAATCGGTGTGGCGG
GCGGTCCATAAGCTGCGGCCGGCTCCGGAAGATGCATGGTACCGGGCATTCACGCCAAGGACGAAAATCA
AGTTGAACGTCGATGTCGGGCAGCAGACGGTGACGATTACAGAATTGGAATGA