SecReT6
Protein ID: 126456659
SecReT6 ID187
T6SS typei3
Gene symbol-
Locus tagBURPS1106A_A0702
StrainBurkholderia pseudomallei 1106a
Repliconchromosome II [GenBank: NC_009078] [Browse all T6SS(s) in this replicon]
Location [Strand]686334..686861 [+]
Producthypothetical protein
NoteTssD
UniProt IDA3P328
KEGG IDbpl:BURPS1106A_A0702
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.10E-32, Aligned region: 9..150
Protein Sequence: 175 a.a.     [Download]
>gi|126456659|ref|YP_001074738.1| hypothetical protein BURPS1106A_A0702 [Burkholderia pseudomallei 1106a]
MANALVDYFLQIDGVEGESTDQQYPGLIQIQSWQWAEENSGRWGFGSGGGAGKVEMKDFEFRMVSNKASP
KLFLMCATGEHIQNAKLICRKSGKGQQEFLTISFASGLVSSFRTLGNMPISQLGHASGEVDGVLPTDQIR
INFAQIEFEYREQRNDGTMGAVIKAGYDLKQNAPI
 
Nucleotide Sequence: 528 bp     [Download]
>gi|126455463|ref|NC_009078.1|:686334-686861 Burkholderia pseudomallei 1106a chromosome II, complete sequence
ATGGCAAATGCTTTGGTTGATTACTTCTTGCAGATCGATGGCGTCGAGGGTGAGTCGACCGATCAGCAAT
ATCCCGGTCTGATCCAGATCCAGAGCTGGCAGTGGGCGGAAGAGAACTCGGGCCGCTGGGGCTTCGGCAG
CGGCGGCGGCGCGGGCAAGGTCGAGATGAAGGACTTCGAGTTCCGCATGGTGTCGAACAAGGCGTCGCCG
AAGCTGTTCCTGATGTGCGCGACGGGTGAGCACATCCAGAACGCGAAGCTGATCTGCCGCAAGTCGGGCA
AGGGCCAGCAGGAGTTCCTGACGATCTCGTTCGCGAGCGGCCTCGTGTCGTCGTTCCGCACGCTCGGCAA
CATGCCGATCTCGCAGCTCGGTCACGCGAGCGGCGAAGTCGACGGCGTGCTGCCGACGGATCAGATCCGC
ATCAACTTCGCCCAGATCGAGTTCGAGTACCGCGAGCAGCGCAACGACGGCACGATGGGCGCCGTGATCA
AGGCGGGCTACGACCTGAAGCAGAACGCGCCGATCTAA