SecReT6
Protein ID: 126456681
SecReT6 ID185
T6SS typei3
Gene symbol-
Locus tagBURPS1106A_A0138
StrainBurkholderia pseudomallei 1106a
Repliconchromosome II [GenBank: NC_009078] [Browse all T6SS(s) in this replicon]
Location [Strand]121132..122490 [+]
Producthypothetical protein
NoteTssK
UniProt IDA3P1H1
KEGG IDbpl:BURPS1106A_A0138
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.70E-143, Aligned region: 23..450
Protein Sequence: 452 a.a.     [Download]
>gi|126456681|ref|YP_001074181.1| hypothetical protein BURPS1106A_A0138 [Burkholderia pseudomallei 1106a]
MIAMSWHNKVVWNEGLFLLPQLFQQQERYFEYFAHKRAAVLSPFFWGFSRYEIDQESLSFGKLVFKSGAG
IFPDGTPFDVPGHTPPPPPLTIAAEHQDQVIYLAVPLRLPNTEETAFDEQAGSLARYSAFEIELRDSNAI
GQGPKPVQLANMRLRLLPEKELTQSWIGIALTRVKTLHADGSVALYDGDHIPPVSQYGANPLLREWATQL
HGLAKLRADALATRLSGSDGRAGAAAEVADYLLLQVLNRYEPLLEHICRIREMPPVTLYRELSMLAGELS
TFVRPQTRRPRPTPGYDHAQLYASIRPLVDEVHYLLNQVLIRGAQPIPLTEQPHGIRVATMLPSELAGYS
SLVLAVGAQMSPDVLQQQFASQTKISHPQRLPELIRSHLPGMTMIPLPVPPRQIPFNSSYIYYELSRTGP
FWEQIAQQGGLAMHIAGHFPELKLELWGVRHK
 
Nucleotide Sequence: 1359 bp     [Download]
>gi|126455463|ref|NC_009078.1|:121132-122490 Burkholderia pseudomallei 1106a chromosome II, complete sequence
ATGATTGCGATGAGTTGGCATAACAAAGTGGTGTGGAACGAAGGACTGTTTCTTCTTCCCCAGCTGTTTC
AACAACAGGAACGGTATTTCGAATATTTCGCGCACAAGCGGGCCGCGGTCCTCAGCCCGTTTTTCTGGGG
ATTCAGCCGATACGAAATCGATCAGGAGTCGCTATCGTTCGGCAAGCTCGTGTTCAAGAGCGGTGCGGGA
ATATTTCCCGACGGAACGCCGTTCGACGTGCCGGGGCACACGCCGCCGCCGCCGCCGCTGACGATCGCCG
CCGAGCATCAGGATCAGGTGATTTATCTCGCGGTGCCGCTGCGTCTACCGAATACGGAGGAGACCGCGTT
CGACGAACAAGCGGGATCGCTTGCGCGCTATTCGGCGTTCGAGATCGAATTGCGCGACAGCAATGCGATC
GGTCAAGGGCCCAAGCCGGTACAGCTCGCGAACATGCGGCTGCGCCTGCTGCCGGAAAAGGAGCTGACGC
AGTCCTGGATCGGTATTGCCTTGACGCGCGTGAAGACGCTTCACGCCGACGGCTCGGTCGCGCTGTACGA
CGGTGACCACATCCCGCCCGTCAGCCAGTACGGAGCGAACCCGCTGCTGCGCGAATGGGCGACCCAGTTG
CACGGCCTCGCGAAACTGCGAGCCGACGCGCTGGCGACGCGCCTGTCCGGCAGCGATGGCCGGGCCGGGG
CGGCGGCCGAGGTGGCGGATTATTTGTTGCTGCAGGTGCTGAACCGGTATGAACCGCTGCTCGAGCACAT
CTGCAGGATTCGCGAAATGCCGCCCGTCACGCTCTATCGCGAGCTGTCGATGCTGGCAGGCGAATTGTCG
ACGTTCGTGCGCCCGCAAACGCGCCGTCCGCGGCCGACGCCCGGTTACGATCATGCGCAGTTGTATGCGA
GCATTCGCCCGCTGGTCGACGAGGTGCACTACCTGTTGAACCAGGTTCTGATTCGAGGCGCGCAGCCGAT
CCCGCTCACCGAGCAGCCGCACGGCATTCGCGTGGCCACGATGTTGCCGTCGGAACTCGCGGGCTATTCG
AGCCTCGTGCTCGCCGTGGGCGCGCAAATGTCGCCGGACGTGTTGCAGCAGCAGTTCGCATCCCAAACGA
AGATCAGCCATCCGCAGCGGCTGCCGGAGCTCATTCGCTCTCATTTGCCGGGCATGACGATGATTCCGTT
GCCGGTGCCTCCGCGGCAGATTCCGTTCAATTCCAGCTATATCTATTACGAGCTATCCCGCACGGGGCCG
TTCTGGGAACAGATTGCGCAACAAGGCGGGCTGGCGATGCACATCGCGGGCCACTTCCCTGAACTCAAGC
TCGAACTTTGGGGAGTGCGTCACAAATGA