SecReT6
Protein ID: 126456731
SecReT6 ID187
T6SS typei3
Gene symbol-
Locus tagBURPS1106A_A0709
StrainBurkholderia pseudomallei 1106a
Repliconchromosome II [GenBank: NC_009078] [Browse all T6SS(s) in this replicon]
Location [Strand]695555..697843 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDA3P335
KEGG IDbpl:BURPS1106A_A0709
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.10E-70, Aligned region: 23..327
Phage_base_V [PF04717], Evalue: 3.60E-22, Aligned region: 365..458
Protein Sequence: 762 a.a.     [Download]
>gi|126456731|ref|YP_001074745.1| Rhs element Vgr protein [Burkholderia pseudomallei 1106a]
MRLIELRSPLLDPDAVALSFVVHENLSQEPSYQLDLLSHDSNLDFDALLGSTLSADIDLGEGDIRTFNTH
VFGGYDTGQMSGQYTYTLELRSWLSFLAENRNSRIFQDLSVPQIVEQVFQGHQRNGYRFELEGTYEPREY
CVQFQETDLNFVKRLLEDEGIYFWVEHEPDRHVVVISDTQRFEDLPLPNDTLEYLPDGEESRAIQGREGV
QRLQRTRRIKSNNVALRDFDYHAPSKQLDSDAQVEQQSLGGIPLEYYDYAAGYRDPEQGERLARLRLEAI
QADAHALGGEANARALAVGRAFTLVGHPALSRNRRYYVTNSELTFIQDGPDSTSQGRNVAVKFRALADDQ
PFRPLLVTKRPRVPGIQSATVVGPEMSEVHTDKLGRIRVHFHWDRYKTTEADASCWIRVTQAWAGKGWGV
LAMPRVGQEVIVVYVDGDLDRPLATGIVYNGENPTPYDLPKDIRYTGLVTRSIKRAGGIPNASQLTFDDQ
HGAERVMIHAERDLQQTVERNSSTSIAQDLNLSVKGTSTSVVGISVSFTGISVSYTGLSVSFTGVSARFT
GVSTSFTGVSTSFTGVSTSFTGVDTSFTGVSTGFKGVDTSFTGVATSMVGVSTSITGSSNSVTGVSNSMT
GISSSWKDVSMSTTGQSESITGVSLSYTGTSNSMTGTSTSVTGTSTSITGTSMSNTGSSTSITGTSMSTT
GSSVSTTGSSMSATGSSVGTTGSSVSTTGSKMSVTGFSFSYTGASYEDVGVDLKKLGMQTKN
 
Nucleotide Sequence: 2289 bp     [Download]
>gi|126455463|ref|NC_009078.1|:695555-697843 Burkholderia pseudomallei 1106a chromosome II, complete sequence
ATGCGTCTGATCGAACTGCGCAGTCCCCTGCTGGACCCGGACGCCGTCGCGCTGAGCTTCGTGGTGCACG
AGAACCTGTCGCAGGAGCCGTCGTATCAGCTCGATTTGCTGAGCCACGATTCGAATCTGGACTTCGACGC
GCTGCTCGGCTCGACGCTGTCGGCCGACATCGACCTGGGCGAAGGCGACATCCGGACGTTCAACACGCAC
GTGTTCGGCGGCTACGACACGGGGCAGATGAGCGGGCAATACACGTACACGCTGGAGCTGCGAAGCTGGT
TGTCGTTTCTCGCGGAGAACCGCAACAGCCGGATCTTCCAGGATTTGAGCGTGCCGCAGATCGTCGAGCA
GGTGTTCCAGGGCCATCAGCGCAACGGCTACCGGTTCGAGCTCGAAGGCACGTACGAGCCGCGCGAGTAC
TGCGTGCAGTTTCAGGAAACGGATCTGAACTTCGTGAAGCGGCTGCTGGAGGACGAAGGGATCTACTTCT
GGGTGGAGCACGAGCCGGACCGTCATGTGGTGGTGATCTCGGACACGCAGCGGTTCGAGGATCTGCCGCT
GCCGAACGACACGCTGGAGTATTTGCCGGACGGCGAGGAGTCGCGCGCGATCCAGGGGCGCGAAGGGGTG
CAGCGGCTGCAGCGCACGCGGCGGATCAAGTCGAACAACGTCGCGCTGCGGGATTTCGACTATCACGCGC
CGTCGAAGCAACTGGACAGCGACGCGCAGGTCGAGCAGCAGAGTCTCGGCGGCATTCCGCTCGAGTACTA
CGACTACGCGGCCGGCTACCGCGACCCCGAGCAGGGCGAGCGTCTCGCGCGGCTGCGGCTCGAAGCGATT
CAGGCTGATGCACACGCGCTCGGGGGCGAGGCGAACGCACGCGCGCTGGCGGTGGGTCGCGCGTTCACGC
TGGTCGGCCATCCGGCGCTGAGCCGCAATCGTCGGTACTACGTGACGAACAGCGAGCTGACGTTCATCCA
GGACGGACCGGACAGCACGTCGCAGGGGCGCAACGTCGCGGTGAAGTTCCGCGCGCTCGCCGACGATCAG
CCGTTTCGGCCGCTGCTCGTCACCAAGCGGCCGCGCGTGCCGGGCATCCAGAGCGCGACGGTGGTGGGCC
CGGAGATGTCGGAGGTGCATACCGACAAGCTCGGGCGGATTCGCGTGCACTTCCACTGGGACCGCTACAA
GACGACCGAGGCGGACGCGTCGTGCTGGATTCGCGTGACGCAGGCATGGGCGGGCAAGGGCTGGGGTGTG
CTCGCGATGCCGCGGGTCGGGCAGGAAGTCATCGTCGTGTATGTCGACGGCGATCTCGACCGGCCGCTCG
CGACGGGCATCGTCTACAACGGCGAAAACCCGACGCCTTATGACCTGCCGAAGGATATCCGCTACACGGG
CCTCGTCACACGCTCGATCAAGCGGGCGGGCGGCATTCCGAATGCGAGCCAACTGACGTTCGACGATCAG
CACGGCGCGGAGCGCGTGATGATCCACGCGGAGCGCGACTTGCAGCAGACGGTCGAGCGCAACAGCTCGA
CGTCGATCGCGCAGGATTTGAACCTGTCGGTGAAGGGCACGTCGACGTCGGTCGTCGGCATCTCGGTCAG
CTTCACGGGCATCTCGGTGTCGTACACGGGGTTGTCGGTGAGCTTCACCGGCGTGTCGGCGAGGTTCACG
GGCGTGAGCACGTCGTTTACCGGCGTGAGCACGAGTTTCACCGGCGTGTCGACGTCGTTTACCGGCGTCG
ATACCAGCTTCACCGGCGTCTCGACCGGATTCAAGGGCGTCGACACGAGCTTCACCGGCGTCGCGACGTC
GATGGTGGGCGTGTCGACGAGCATCACGGGCTCCAGCAATTCCGTGACGGGCGTGTCGAACAGCATGACG
GGCATCTCGTCTTCCTGGAAGGACGTGAGCATGTCGACGACCGGCCAGTCCGAAAGCATCACGGGAGTAT
CGCTGTCGTACACGGGCACGTCGAACAGCATGACGGGCACGAGCACGTCGGTGACGGGCACCTCGACGAG
CATCACCGGCACGTCGATGTCGAACACCGGCAGCTCGACGAGCATCACGGGCACATCGATGTCGACGACG
GGCAGCTCGGTGAGCACGACGGGCTCGAGCATGTCGGCCACCGGCAGTTCGGTGGGCACGACGGGCTCGA
GCGTATCGACGACGGGAAGCAAGATGTCGGTCACCGGCTTCAGCTTCTCGTATACGGGAGCGAGCTACGA
GGATGTGGGCGTCGATCTGAAAAAGCTCGGGATGCAGACGAAGAACTGA