SecReT6
Protein ID: 126456784
SecReT6 ID185
T6SS typei3
Gene symbolsciM
Locus tagBURPS1106A_A0136
StrainBurkholderia pseudomallei 1106a
Repliconchromosome II [GenBank: NC_009078] [Browse all T6SS(s) in this replicon]
Location [Strand]119983..120465 [+]
ProductSciM protein
NoteTssD
UniProt IDA3P1G9
KEGG IDbpl:BURPS1106A_A0136
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.00E-40, Aligned region: 6..136
Protein Sequence: 160 a.a.     [Download]
>gi|126456784|ref|YP_001074179.1| SciM protein [Burkholderia pseudomallei 1106a]
MSHDIFLKINGIDGEAEDATHKSEIEVLSWSWNVSQQSNMHLGSGGGAGKATIDDLQFEHYIDRASPNLV
QYCLLGKHIDEARLVVRKAGGSPLEYIKLTMSDVLVTQVSPAGVAQDESRPRELVRLSFSRLKQEYVVQN
PQGGSGGAITATFDIKKNAA
 
Nucleotide Sequence: 483 bp     [Download]
>gi|126455463|ref|NC_009078.1|:119983-120465 Burkholderia pseudomallei 1106a chromosome II, complete sequence
ATGTCGCACGACATTTTCCTCAAGATCAACGGTATCGATGGCGAGGCGGAAGACGCAACCCACAAGAGCG
AAATCGAGGTCTTGAGCTGGTCGTGGAACGTCAGTCAGCAATCGAACATGCACCTGGGTTCGGGGGGCGG
CGCGGGCAAGGCGACGATCGATGATCTGCAGTTCGAACATTACATCGATCGCGCGAGCCCGAATCTCGTT
CAATACTGCTTGCTCGGCAAGCATATCGACGAAGCCCGGCTCGTGGTGCGTAAGGCGGGCGGCAGCCCGC
TCGAATACATCAAGCTCACGATGAGCGATGTGCTCGTTACGCAGGTGAGCCCGGCAGGCGTGGCTCAGGA
CGAATCGCGCCCGCGTGAGCTCGTTCGGCTGTCGTTCTCGCGCCTGAAGCAAGAGTATGTCGTCCAGAAC
CCGCAGGGCGGCAGCGGCGGCGCAATCACCGCGACTTTCGACATCAAGAAGAACGCGGCGTAA