SecReT6
Protein ID: 126456857
SecReT6 ID188
T6SS typei1
Gene symbol-
Locus tagBURPS1106A_A2038
StrainBurkholderia pseudomallei 1106a
Repliconchromosome II [GenBank: NC_009078] [Browse all T6SS(s) in this replicon]
Location [Strand]2010722..2012155 [+]
Producthypothetical protein
NoteTssK
UniProt IDA3P6W1
KEGG IDbpl:BURPS1106A_A2038
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.70E-98, Aligned region: 28..474
Protein Sequence: 477 a.a.     [Download]
>gi|126456857|ref|YP_001076071.1| hypothetical protein BURPS1106A_A2038 [Burkholderia pseudomallei 1106a]
MTHDASRTGTNDMDNVYWHQGMLLQPQHFQLAELHQQFRFEPWLACGPPHFWGVGALSLAQAAIDRRVVE
IRSARLLFADRSYVEYPGNAVVAARAFDPAWLDEGRALVAHVALRRLARGANNVTVAAAPDALPDAPTRY
ATLPSAEEVADLHSDHPGAPVRTLKHVLKIVFEHELDALAAHETIPIARIVRDGERLRLDDDFAPPCYAL
SGSRTLLERVRCIRDELAGRARQLQQYKNPREMQRAEFDASYAAFLLALRSLNRFGPLLFHLAECDGQHP
WTVYGVLRQLVGELSVFSERFDMLGETPDARGGLPPYDHRDLGGCFSRAHALIGHLLDEIAVGPDCVATF
EPDGPQQPAQRSAQLPPDVFADRHQIYLAIRSAHDPDTLAQRFALGGRIAATDEMPQLTALALPGVELTR
LPGPPPRLPRRGDARYFRIEQAGRPWDAIRRDGRVSLRWADAPDDLHAELVAVRHTQ
 
Nucleotide Sequence: 1434 bp     [Download]
>gi|126455463|ref|NC_009078.1|:2010722-2012155 Burkholderia pseudomallei 1106a chromosome II, complete sequence
ATGACGCACGACGCATCACGAACCGGAACGAACGACATGGACAACGTCTATTGGCATCAGGGGATGCTGC
TGCAACCGCAACATTTTCAGTTGGCCGAACTGCACCAGCAGTTCCGCTTCGAGCCGTGGCTCGCGTGCGG
CCCGCCGCATTTCTGGGGCGTCGGCGCGCTGTCGCTCGCGCAGGCCGCGATCGATCGCCGCGTGGTCGAG
ATCCGCTCGGCGCGCCTGCTGTTCGCCGATCGCAGCTACGTCGAATATCCGGGCAACGCGGTCGTCGCCG
CGCGCGCGTTCGATCCCGCGTGGCTCGACGAAGGCCGCGCGCTCGTCGCGCACGTCGCGCTCAGGCGGCT
CGCGCGCGGCGCGAACAACGTGACGGTCGCGGCCGCGCCCGACGCGCTGCCCGACGCCCCGACGCGCTAC
GCGACGCTGCCGTCCGCCGAGGAGGTCGCCGATCTGCATTCGGACCATCCGGGCGCGCCGGTGCGCACGC
TCAAGCACGTGCTGAAGATCGTGTTCGAGCACGAGCTCGACGCGCTCGCCGCGCACGAAACGATCCCGAT
CGCGCGGATCGTGCGCGACGGCGAGCGCCTGCGGCTCGACGACGATTTCGCGCCGCCCTGCTACGCGCTG
TCGGGCTCGCGCACGCTGCTCGAGCGCGTGCGCTGCATTCGCGACGAGCTCGCGGGCCGCGCGCGGCAGT
TGCAGCAGTACAAGAATCCGCGCGAGATGCAACGCGCCGAATTCGACGCGAGCTATGCGGCGTTCCTGCT
CGCGCTGCGTTCGCTGAACCGCTTCGGCCCGCTGCTGTTCCATCTCGCCGAATGCGACGGGCAGCATCCA
TGGACGGTCTACGGCGTGCTGCGCCAACTCGTCGGCGAGCTGAGCGTGTTCTCCGAGCGCTTCGACATGC
TCGGCGAGACGCCCGATGCGCGCGGCGGCCTGCCGCCGTACGACCACCGCGATCTGGGCGGCTGCTTCTC
GCGCGCGCACGCGCTGATCGGCCACCTGCTCGACGAAATCGCGGTGGGCCCGGACTGCGTCGCGACGTTC
GAGCCCGACGGCCCGCAGCAGCCCGCGCAACGCTCGGCGCAACTGCCGCCCGACGTGTTCGCGGATCGCC
ACCAGATCTATCTCGCGATCCGCAGCGCGCACGATCCGGACACGCTCGCGCAACGCTTCGCGCTCGGCGG
CCGGATCGCGGCGACCGACGAAATGCCGCAGCTCACCGCGCTCGCGCTGCCGGGCGTCGAACTCACCCGC
CTGCCCGGCCCGCCGCCGCGGCTGCCGCGCCGCGGCGACGCGCGCTACTTCCGGATCGAGCAGGCCGGCC
GCCCGTGGGACGCGATCCGGCGTGACGGCCGCGTGTCGCTGCGCTGGGCCGACGCGCCGGACGACCTGCA
CGCGGAACTCGTCGCGGTGAGGCACACGCAATGA