SecReT6
Protein ID: 126456923
SecReT6 ID189
T6SS typei3
Gene symbol-
Locus tagBURPS1106A_A2836
StrainBurkholderia pseudomallei 1106a
Repliconchromosome II [GenBank: NC_009078] [Browse all T6SS(s) in this replicon]
Location [Strand]2779743..2780822 [-]
ProductImpA-related N-terminal family protein
NoteTssA
UniProt IDA3P955
KEGG IDbpl:BURPS1106A_A2836
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.10E-23, Aligned region: 56..116
Protein Sequence: 359 a.a.     [Download]
>gi|126456923|ref|YP_001076865.1| ImpA-related N-terminal family protein [Burkholderia pseudomallei 1106a]
MQSSDPIESLLAGVAPDAPCGANLEYEQDFLRLQESATPRPEQQYGDTVIPAEAPDWSAVERLALELTAR
TKDLRVAAHLARSWTELRGMPGYADGLRLVAGMLDRWWDDVHPRLDADGDHDPAPRANALAEIAGAHDCA
RAARRQALFDGGPSVRDAERVFDGRDGGEHGYPGGRERLIADLVRARDGGQPTLQAAFAALDALDAIRAR
VASALGGEWVPDASDFEKALRRIVRDGLPPPAAGPAATNGAANVANAAHGGAANGVTNSAANGAASGGAP
AFAANGRAWRDAELTSRDDVQLGLEKMCRYFELHEPSHPAPILLRRAQRLLSLDFYEIIRDLAPESLPKL
DLLSGQRNE
 
Nucleotide Sequence: 1080 bp     [Download]
>gi|126455463|ref|NC_009078.1|:c2780822-2779743 Burkholderia pseudomallei 1106a chromosome II, complete sequence
ATGCAGAGTTCAGACCCGATCGAATCGTTGCTCGCCGGCGTCGCGCCCGACGCGCCGTGCGGCGCGAATC
TCGAATACGAGCAGGATTTCCTGCGGCTGCAGGAGAGCGCGACGCCGCGGCCCGAACAGCAGTACGGCGA
CACCGTGATCCCGGCCGAAGCGCCGGACTGGAGCGCGGTCGAGCGTCTCGCGCTCGAGCTGACGGCGCGC
ACGAAGGATCTGCGCGTGGCCGCGCATCTCGCGCGCAGTTGGACCGAACTGCGCGGCATGCCCGGCTACG
CGGACGGGCTGAGGCTCGTCGCGGGGATGCTGGACCGGTGGTGGGACGACGTGCACCCGCGCCTGGACGC
CGACGGCGACCACGACCCGGCCCCGCGCGCGAACGCGCTGGCGGAAATCGCGGGCGCGCACGACTGCGCG
CGCGCCGCGCGCCGGCAGGCGCTCTTCGATGGCGGCCCGAGCGTGCGCGATGCCGAGCGCGTGTTCGATG
GCCGCGACGGCGGCGAGCACGGCTACCCGGGCGGCCGCGAGCGGCTGATCGCCGATCTGGTTCGCGCGCG
CGACGGCGGGCAGCCGACGCTGCAGGCGGCGTTCGCCGCGCTCGACGCGCTCGATGCGATTCGCGCGCGC
GTCGCATCGGCGCTCGGCGGCGAATGGGTGCCCGACGCGAGCGACTTCGAGAAGGCGCTGCGCCGGATCG
TGCGCGACGGGTTGCCGCCGCCCGCGGCCGGGCCCGCCGCGACAAACGGTGCGGCGAATGTGGCGAATGC
GGCGCACGGCGGCGCGGCAAACGGCGTCACGAACAGTGCCGCGAACGGCGCGGCTTCGGGCGGCGCGCCG
GCTTTCGCCGCGAACGGCCGCGCGTGGCGCGATGCGGAGCTGACGAGCCGCGACGACGTTCAGCTCGGCC
TCGAAAAAATGTGCCGCTACTTCGAGCTGCACGAGCCGAGCCATCCGGCGCCGATCCTGCTGCGCCGCGC
GCAGCGGCTGCTGTCGCTCGACTTCTACGAAATCATCCGGGATCTCGCGCCGGAGAGCCTGCCGAAGCTC
GACTTGCTGAGCGGCCAGCGCAACGAATGA