SecReT6
Protein ID: 126456983
SecReT6 ID189
T6SS typei3
Gene symbol-
Locus tagBURPS1106A_A2843
StrainBurkholderia pseudomallei 1106a
Repliconchromosome II [GenBank: NC_009078] [Browse all T6SS(s) in this replicon]
Location [Strand]2791000..2791518 [-]
Productputative lipoprotein
NoteTssJ
UniProt IDA3P962
KEGG IDbpl:BURPS1106A_A2843
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 3.20E-38, Aligned region: 14..160
Protein Sequence: 172 a.a.     [Download]
>gi|126456983|ref|YP_001076872.1| putative lipoprotein [Burkholderia pseudomallei 1106a]
MRPRFSVSVVLGCALLLAGCGATERSVAVPYSITLDVAPDVNPDLNRKPSPIVLKVFQLKTASAFESADF
FSLQDKPQSVLGADLLGVDRIILRPGDARTLHYRGNVDAGAIGIVAEYRVLEKNRWRMTVPLPRAKQLNL
YRFWQTSPGEMKLQVAVKNGGIGLGGDSRVRQ
 
Nucleotide Sequence: 519 bp     [Download]
>gi|126455463|ref|NC_009078.1|:c2791518-2791000 Burkholderia pseudomallei 1106a chromosome II, complete sequence
ATGCGACCGCGGTTCAGTGTTTCCGTCGTTCTGGGATGCGCGCTGCTGCTCGCCGGATGCGGGGCGACCG
AGCGTTCCGTTGCGGTGCCGTATTCGATCACGCTCGACGTCGCGCCCGACGTCAATCCGGACCTCAATCG
CAAGCCGTCGCCGATCGTGCTGAAGGTGTTCCAGCTGAAGACGGCGTCCGCGTTCGAAAGCGCCGATTTC
TTCTCGCTGCAGGACAAGCCGCAGAGCGTGCTCGGCGCGGATCTGCTCGGCGTCGACCGGATCATCCTGC
GCCCGGGGGATGCGCGCACGCTGCACTATCGCGGCAACGTCGACGCGGGCGCGATCGGCATCGTCGCCGA
ATATCGCGTGCTCGAGAAGAACCGCTGGCGGATGACGGTGCCGCTGCCGCGCGCGAAGCAACTGAACCTG
TACCGATTCTGGCAAACCTCGCCGGGCGAGATGAAGCTGCAGGTCGCCGTGAAGAACGGCGGCATCGGCC
TCGGCGGCGATTCGCGAGTACGCCAATGA