SecReT6
Protein ID: 126457271
SecReT6 ID185
T6SS typei3
Gene symbol-
Locus tagBURPS1106A_A0143
StrainBurkholderia pseudomallei 1106a
Repliconchromosome II [GenBank: NC_009078] [Browse all T6SS(s) in this replicon]
Location [Strand]128568..131258 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDA3P1H6
KEGG IDbpl:BURPS1106A_A0143
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 4.50E-78, Aligned region: 41..368
Phage_base_V [PF04717], Evalue: 8.30E-25, Aligned region: 408..501
Gp5_C [PF06715], Evalue: 0.0036, Aligned region: 552..572
Gp5_C [PF06715], Evalue: 0.0036, Aligned region: 585..601
Gp5_C [PF06715], Evalue: 0.0036, Aligned region: 593..614
Gp5_C [PF06715], Evalue: 0.0036, Aligned region: 613..630
Gp5_C [PF06715], Evalue: 0.0036, Aligned region: 618..637
Protein Sequence: 896 a.a.     [Download]
>gi|126457271|ref|YP_001074186.1| Rhs element Vgr protein [Burkholderia pseudomallei 1106a]
MPNHFSNGRTNQSRTVVIRSGAMPRLLGQPALEFLSLRGEEHLGKLYTYELLLRTPDDFHVPLATSANLD
LKAMIGTEMTVCIQLDGIGTGAQGGVGAGAREISGLVVKAGFLRCEGRYNVYRIELRPWLWLATLTSDYK
IFQDKSVVEIIDTVLHDYPYPVEKRLDIDKYSVAGESARNEPRAFQVQYGETDFDFVQRLMEEWGIYWFF
EHSDNKHRLVLCDHIGGHRKAPSEAYHEIAHHPEGGKIDIEYINYFSTDEALRPGRVVIDDFDFTRPLAS
LVTSNHQPRETNWGEGELFEWPGDYTDSKHGDLISRVRMEERRATGSRAYGRGNVRGLACGHTFVLSKHK
HDGANREYLVIESALMLTEVADETGSGYRYECDNELVVQPSNEVFRMPRETPKPTTSGPQSAIVVGPPGH
EVWTDEFGRVKIRFLWDRYARNDATDSCWVRVSQAWAGVNFGGIYIPRIGQEVIVGFMNGDPDRPLILGS
LYNTITPPPWDLPGDATKSGFKSKSITGGRENYNGIRFEDKLGAEEFHMQAEKDMNRLTKNDESHTVGAN
FSIGVGLTHTRAVGAMFSSIVGGAASYAVGGAESTMIGGAYALNVGGAHAVAVGGASSVSVGGAYARNVG
GAYALTVGGVLSIVCGASSITMTACGSIKIVGKNIRIIGSDEVVVQGAPLQLNPGDSDCGGGGGGGGGGG
AIPPIPLPSFFLDITKPILPPPPPPPTEVPPDPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPT
PTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPT
PTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTSSEI
 
Nucleotide Sequence: 2691 bp     [Download]
>gi|126455463|ref|NC_009078.1|:128568-131258 Burkholderia pseudomallei 1106a chromosome II, complete sequence
ATGCCAAACCATTTTTCGAACGGACGGACGAATCAAAGCCGCACGGTAGTGATCCGCAGCGGTGCGATGC
CGCGGCTGCTCGGTCAGCCCGCGCTCGAGTTCCTGTCGCTGCGCGGTGAAGAGCACCTCGGAAAACTCTA
CACGTACGAATTGCTCCTGCGCACGCCGGACGATTTTCATGTGCCGTTGGCAACGAGCGCGAATCTCGAC
CTGAAGGCGATGATCGGCACGGAGATGACGGTCTGCATTCAGCTCGACGGAATCGGGACGGGCGCGCAAG
GCGGCGTTGGCGCGGGTGCGCGCGAAATCAGCGGGCTCGTGGTCAAGGCGGGCTTCCTGCGCTGCGAGGG
GCGCTACAACGTCTATCGCATCGAGCTGCGCCCCTGGCTGTGGCTCGCGACTTTGACGAGCGACTACAAG
ATTTTTCAGGACAAGAGCGTCGTCGAAATCATCGATACGGTCTTGCACGATTACCCTTACCCGGTCGAGA
AGCGGCTCGACATCGACAAGTATTCGGTGGCGGGCGAGAGCGCTCGAAACGAGCCGCGCGCGTTCCAGGT
GCAATATGGCGAAACCGATTTCGACTTCGTTCAGCGTTTGATGGAGGAGTGGGGGATCTACTGGTTCTTC
GAGCATTCGGACAACAAGCATCGCCTGGTCTTGTGCGATCACATCGGCGGGCATCGCAAGGCGCCGAGCG
AGGCCTATCACGAGATCGCGCATCACCCGGAAGGCGGGAAGATCGACATCGAGTACATCAACTATTTCTC
GACGGACGAAGCGCTGCGGCCCGGCCGCGTCGTGATAGACGATTTCGACTTCACGCGTCCGCTCGCGAGC
CTCGTCACGTCCAATCACCAGCCGCGGGAGACGAACTGGGGGGAGGGCGAGCTGTTCGAATGGCCGGGCG
ACTATACCGATAGCAAGCATGGCGATCTCATCAGCCGCGTGCGCATGGAAGAGCGCCGCGCGACCGGGTC
GCGCGCATACGGTCGGGGCAACGTGCGCGGCCTCGCCTGCGGTCATACGTTCGTGCTGTCGAAGCACAAG
CACGACGGCGCGAACCGCGAGTACCTCGTCATCGAATCGGCGTTGATGCTGACCGAAGTCGCGGACGAAA
CGGGCAGCGGCTACCGCTACGAATGCGATAACGAACTGGTCGTGCAGCCGTCGAACGAGGTGTTTCGAAT
GCCGCGCGAAACGCCCAAGCCGACGACGAGCGGGCCACAGTCCGCGATCGTGGTCGGGCCGCCGGGCCAC
GAGGTATGGACCGACGAATTCGGCCGCGTGAAGATCCGTTTTCTGTGGGATCGCTACGCACGCAATGACG
CAACGGATTCCTGCTGGGTACGCGTGAGCCAGGCGTGGGCCGGCGTGAACTTCGGCGGCATCTACATTCC
GCGGATCGGACAGGAAGTGATCGTCGGATTCATGAACGGCGATCCGGACCGTCCGCTGATTCTCGGCAGC
CTCTACAACACCATTACGCCGCCGCCTTGGGATCTGCCCGGCGACGCGACGAAGAGCGGATTCAAGAGCA
AGTCGATCACGGGCGGGCGCGAGAACTATAACGGCATCCGCTTCGAGGACAAGCTGGGGGCCGAGGAATT
TCACATGCAGGCGGAAAAGGACATGAACCGCCTGACGAAGAACGACGAGTCGCATACGGTCGGCGCGAAT
TTTTCGATCGGCGTCGGGCTTACCCATACGCGCGCGGTGGGCGCCATGTTCAGCAGCATCGTCGGCGGAG
CCGCCAGCTATGCGGTGGGGGGCGCGGAATCGACGATGATCGGCGGCGCGTATGCGTTGAACGTCGGCGG
CGCGCACGCGGTTGCGGTGGGCGGCGCGTCGTCCGTTTCCGTTGGCGGCGCCTACGCGCGCAACGTGGGC
GGCGCGTATGCGCTGACAGTCGGCGGCGTGCTGTCGATCGTCTGCGGTGCGTCTTCGATCACCATGACGG
CTTGCGGCTCGATCAAGATCGTCGGCAAGAATATTCGCATCATCGGCAGCGACGAAGTCGTCGTGCAAGG
CGCGCCCCTGCAACTGAATCCGGGCGATTCGGATTGCGGCGGAGGGGGCGGCGGCGGAGGCGGCGGCGGC
GCGATTCCGCCGATTCCGTTGCCGTCGTTCTTCCTCGATATCACGAAGCCGATTCTTCCGCCGCCGCCGC
CGCCACCGACGGAGGTGCCACCGGATCCGACGCCGACGCCCACGCCGACGCCGACGCCGACGCCCACGCC
GACGCCGACGCCGACGCCCACGCCGACGCCGACGCCGACGCCCACGCCGACGCCGACGCCGACGCCCACG
CCGACGCCCACGCCCACGCCCACGCCGACGCCGACGCCGACGCCGACGCCGACGCCGACGCCCACGCCGA
CGCCCACGCCCACGCCGACGCCCACGCCCACGCCGACGCCCACGCCGACGCCCACGCCGACGCCAACGCC
AACGCCAACGCCAACGCCGACGCCCACGCCCACGCCGACGCCCACGCCGACGCCAACGCCGACGCCGACG
CCGACGCCGACGCCGACGCCGACGCCCACGCCGACGCCCACGCCGACGCCCACGCCCACGCCCACGCCGA
CGCCAACGCCAACGCCCACGCCGACGCCCACGCCCACGCCGACGCCGACGCCGACGCCAACGCCAACACC
AACGCCAACTCCGACTAGTTCCGAGATTTAA