SecReT6
Protein ID: 126457277
SecReT6 ID188
T6SS typei1
Gene symbol-
Locus tagBURPS1106A_A2039
StrainBurkholderia pseudomallei 1106a
Repliconchromosome II [GenBank: NC_009078] [Browse all T6SS(s) in this replicon]
Location [Strand]2012152..2012817 [+]
Producthypothetical protein
NoteTssL
UniProt IDA3P6W2
KEGG IDbpl:BURPS1106A_A2039
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 9.10E-44, Aligned region: 1..208
Protein Sequence: 221 a.a.     [Download]
>gi|126457277|ref|YP_001076072.1| hypothetical protein BURPS1106A_A2039 [Burkholderia pseudomallei 1106a]
MKLTDSMMPLVAYARQLAQSPRGDAAEVALRLDILIERARDHAACAGAPAADVDDALFAVCAWIDEALLN
SGWDDADRWTLRLLQKRYFDTSHAGVVFFERLGTLDGARASVLEVYLLCLRLGFRGRYGYDGGDGPLDAI
RQRALDALSAHAPPCAAGEPPFPAAYAHAGPHAAAAKARTRRRIARAGLSVGLPLAILLSLYLIYHVVIV
RMVDAVYPRLQ
 
Nucleotide Sequence: 666 bp     [Download]
>gi|126455463|ref|NC_009078.1|:2012152-2012817 Burkholderia pseudomallei 1106a chromosome II, complete sequence
ATGAAGCTGACCGATTCGATGATGCCGCTCGTCGCGTATGCGCGGCAGCTCGCGCAATCGCCGCGCGGCG
ACGCCGCCGAAGTCGCGCTGCGGCTCGACATCCTGATCGAGCGCGCGCGCGACCACGCGGCGTGCGCGGG
CGCACCCGCGGCCGACGTCGACGACGCGCTGTTCGCGGTGTGCGCGTGGATCGACGAGGCGCTGCTGAAC
AGCGGCTGGGACGATGCCGATCGCTGGACGCTGCGGCTGCTGCAAAAGCGCTACTTCGATACGTCGCACG
CGGGCGTCGTGTTCTTCGAACGCCTCGGCACGCTCGACGGCGCGCGCGCGAGCGTGCTCGAGGTCTACCT
GCTGTGCCTGCGGCTCGGCTTTCGCGGCCGCTACGGCTACGACGGCGGCGACGGCCCGCTCGACGCGATC
CGCCAGCGCGCGCTCGATGCACTGTCGGCGCACGCGCCGCCGTGCGCCGCGGGCGAGCCGCCGTTTCCCG
CCGCCTATGCGCACGCCGGCCCGCACGCCGCCGCCGCGAAAGCGCGCACGCGCCGCCGGATCGCGCGCGC
GGGGCTGAGCGTCGGGCTGCCGCTCGCCATCCTGCTGTCGCTCTATCTGATCTATCACGTCGTCATCGTG
CGGATGGTCGACGCGGTGTACCCCAGGCTGCAATGA