SecReT6
Protein ID: 126457308
SecReT6 ID185
T6SS typei3
Gene symbol-
Locus tagBURPS1106A_A0133
StrainBurkholderia pseudomallei 1106a
Repliconchromosome II [GenBank: NC_009078] [Browse all T6SS(s) in this replicon]
Location [Strand]117711..118250 [+]
Producthypothetical protein
NoteTssB
UniProt IDA3P1G6
KEGG IDbpl:BURPS1106A_A0133
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 6.50E-61, Aligned region: 11..163
Protein Sequence: 179 a.a.     [Download]
>gi|126457308|ref|YP_001074176.1| hypothetical protein BURPS1106A_A0133 [Burkholderia pseudomallei 1106a]
MAISNSSQKFIARNRAPRVQIEYDVEIYGSEKKVELPFVMGVLADLSGKPLEPLPAVGDRKFFSIDIDNF
DERMKAMKPRVAFSVPNTLSGDGQLMVDITFESMDDFSPAAIAKKVDALSQLLDARTQLANLQTYMDGKS
GAENLVSKVLKDPALLSALAKAPKPVAEQAENRESKEKH
 
Nucleotide Sequence: 540 bp     [Download]
>gi|126455463|ref|NC_009078.1|:117711-118250 Burkholderia pseudomallei 1106a chromosome II, complete sequence
ATGGCTATATCCAATAGCTCACAGAAATTTATCGCGCGCAATCGTGCGCCTCGCGTTCAGATCGAATACG
ACGTCGAGATTTACGGTTCCGAAAAGAAGGTCGAGCTTCCGTTCGTGATGGGCGTGCTCGCGGACCTGTC
GGGCAAGCCGCTCGAGCCTCTGCCGGCGGTCGGCGACCGCAAGTTCTTCAGCATCGATATCGACAATTTC
GACGAGCGCATGAAGGCGATGAAGCCGCGTGTCGCGTTCTCGGTGCCGAATACTCTTTCCGGCGACGGTC
AATTGATGGTCGACATCACGTTCGAAAGCATGGACGACTTTTCTCCCGCGGCGATCGCGAAGAAGGTGGA
TGCGTTGTCGCAATTGCTGGACGCGCGCACGCAGCTTGCCAATCTGCAGACCTACATGGACGGAAAGTCG
GGCGCGGAGAACCTCGTGAGCAAGGTGCTCAAGGATCCCGCGCTGCTGAGCGCGCTTGCGAAGGCGCCGA
AGCCCGTGGCGGAACAGGCGGAAAACAGGGAATCGAAGGAAAAGCACTGA