SecReT6
Protein ID: 126457335
SecReT6 ID185
T6SS typei3
Gene symbol-
Locus tagBURPS1106A_A0152
StrainBurkholderia pseudomallei 1106a
Repliconchromosome II [GenBank: NC_009078] [Browse all T6SS(s) in this replicon]
Location [Strand]141956..142762 [-]
ProductImpE/SciE family protein
NoteTagJ
UniProt IDA3P1I5
KEGG IDbpl:BURPS1106A_A0152
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 8.70E-44, Aligned region: 139..259
Protein Sequence: 268 a.a.     [Download]
>gi|126457335|ref|YP_001074195.1| ImpE/SciE family protein [Burkholderia pseudomallei 1106a]
MLRDALRAQSFEEIKARTAEAVRKRPSDTRERWLLFQLLCIDGAWERALKQLQTWAGLEPQGEARAQLHR
GLIRCEMFRADVFAGKRTPGFIDAQPAWVDTLLQANAKLGAGDVAAADTLREAAFHCAPVTRGESAEMGS
FAWLTDSDTRLGPIFEIAVAGGYRWIPFEQLKSITFTPAGTLTDLVWRPVTALMLDATVLRGYAPTRYSG
SENGATAIRLASETTWRDIGTTNVVALGQRTWTTDQGDWGMLQIGGCRFTGESDDAAS
 
Nucleotide Sequence: 807 bp     [Download]
>gi|126455463|ref|NC_009078.1|:c142762-141956 Burkholderia pseudomallei 1106a chromosome II, complete sequence
ATGCTGCGCGACGCGCTGCGCGCCCAGTCTTTCGAGGAAATCAAGGCGCGCACGGCCGAGGCGGTCAGAA
AGCGGCCATCCGACACGCGGGAACGCTGGCTACTGTTTCAGTTGCTTTGCATCGACGGCGCGTGGGAGCG
CGCGCTCAAACAGCTGCAAACCTGGGCCGGGCTCGAGCCGCAGGGCGAGGCGCGCGCGCAACTGCATCGC
GGCCTGATCCGATGCGAAATGTTCCGGGCCGACGTGTTTGCCGGCAAGCGAACGCCGGGGTTCATCGACG
CGCAGCCCGCCTGGGTCGACACGCTCCTCCAAGCCAATGCGAAGCTCGGCGCCGGCGACGTCGCGGCGGC
GGACACGCTGCGCGAAGCCGCGTTCCACTGCGCCCCTGTCACCCGCGGGGAAAGCGCCGAAATGGGAAGC
TTCGCATGGCTTACCGACAGCGACACCCGCCTCGGTCCGATCTTTGAAATAGCGGTTGCAGGCGGCTATC
GATGGATTCCGTTCGAACAACTGAAGTCCATCACGTTTACGCCCGCCGGCACGCTGACCGACCTGGTCTG
GCGACCGGTCACGGCACTCATGCTCGATGCCACGGTTCTCCGCGGCTATGCACCCACCCGCTATTCGGGA
TCGGAGAACGGCGCGACCGCGATCCGCTTGGCCAGCGAGACGACCTGGCGCGACATCGGCACCACCAACG
TCGTGGCGCTCGGACAACGAACATGGACCACCGATCAGGGCGACTGGGGCATGCTCCAGATCGGCGGATG
CCGCTTCACGGGCGAAAGCGACGATGCGGCATCCTGA