SecReT6
Protein ID: 126457583
SecReT6 ID188
T6SS typei1
Gene symbol-
Locus tagBURPS1106A_A2022
StrainBurkholderia pseudomallei 1106a
Repliconchromosome II [GenBank: NC_009078] [Browse all T6SS(s) in this replicon]
Location [Strand]1988222..1990093 [-]
ProductImpA-related N-terminal family protein
NoteTssA
UniProt IDA3P6U5
KEGG IDbpl:BURPS1106A_A2022
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.80E-18, Aligned region: 69..128
ImpA-rel_N [PF06812], Evalue: 2.80E-18, Aligned region: 583..593
Protein Sequence: 623 a.a.     [Download]
>gi|126457583|ref|YP_001076055.1| ImpA-related N-terminal family protein [Burkholderia pseudomallei 1106a]
MGMSERRPPGGAAARARMPIDVEALAVLGRTDIDSAMPAGADVRADARFDALHAELAKLASPGASGQVDW
RAATHLAAELLRERGKDLLVGCYLAGALLQTGGAAGLRCGLEIVGDLVERHWDAMSPPVSRMRARRGALQ
WLVDRVDAMHDAGAAACGGACSAELVAQLRAAARRIDALLAERDDDAPTMRAVHAFAERLPVEVVEVVEV
ADEADVAEATEATEATEATEATEAADVAETAETAEADAHGSTGGPAAEIAIAAAEQALIDPAGRAAPSAG
TDTNANADAARQPARLDEAAGRERALADALAQLHCVATAFAQADWADARGFRLRRVACWSSVCALPETDA
ENGRTRIAAPSASIVGAAKNIDGDGEPVAAVRFAEAHAQAFPLWLDLQRIAARALARAGGDGADARREVE
TAVRALLARLPGLDALTFADGTPFADDATRAWLGELGAPVVAADAVSPSSLPLSPRPSPPERSSPMAGEP
ARAPGDACGASADDAVDRACAFAASGQLDLALHAIQHAIDRATSAEQRLRARVRLCELARDHWPHEVPEA
FARGVIEPIRRHDLLAWNPELALDGLSAAYALLIRRDRESAHARTVLDEIASVDAARAMRLST
 
Nucleotide Sequence: 1872 bp     [Download]
>gi|126455463|ref|NC_009078.1|:c1990093-1988222 Burkholderia pseudomallei 1106a chromosome II, complete sequence
ATGGGGATGAGCGAACGGCGCCCGCCCGGCGGCGCGGCGGCGCGCGCGCGCATGCCGATCGATGTCGAAG
CGCTCGCCGTGCTGGGGCGCACGGACATCGATTCCGCCATGCCCGCGGGCGCCGACGTGCGCGCCGACGC
GAGGTTCGACGCGCTGCACGCGGAGCTTGCGAAGCTCGCGTCGCCGGGCGCGAGCGGGCAAGTCGATTGG
CGCGCGGCGACGCATCTCGCCGCCGAATTGCTGCGCGAGCGCGGCAAGGATTTGCTCGTCGGCTGCTATC
TGGCGGGTGCGTTGCTGCAGACGGGCGGCGCGGCGGGGCTGCGCTGCGGACTCGAAATCGTCGGCGATCT
CGTCGAACGTCATTGGGATGCGATGTCGCCGCCCGTGTCGCGGATGCGGGCGAGGCGCGGGGCGCTGCAA
TGGCTGGTCGATCGCGTCGACGCCATGCACGATGCAGGAGCCGCCGCATGCGGCGGCGCGTGCTCGGCCG
AACTGGTCGCGCAATTGCGCGCGGCCGCGCGGCGCATCGATGCGCTGCTCGCCGAGCGCGACGACGACGC
GCCGACGATGCGCGCGGTGCATGCGTTCGCGGAGCGATTGCCGGTTGAGGTGGTTGAGGTGGTGGAAGTG
GCTGACGAGGCTGATGTGGCTGAGGCGACTGAGGCGACTGAGGCGACTGAGGCGACTGAGGCGACTGAGG
CGGCTGATGTGGCTGAGACGGCTGAGACGGCCGAGGCCGATGCGCATGGCTCGACGGGAGGGCCGGCCGC
GGAAATCGCGATTGCCGCTGCCGAACAGGCTTTGATTGATCCGGCCGGTCGAGCCGCGCCGAGCGCAGGC
ACGGATACGAACGCGAACGCAGACGCCGCCAGGCAACCGGCGCGGCTCGACGAAGCGGCCGGCCGCGAAC
GCGCGCTCGCCGATGCGCTCGCGCAACTGCATTGCGTCGCGACGGCGTTCGCGCAAGCGGACTGGGCCGA
CGCGCGCGGCTTCCGGCTGCGCCGCGTCGCGTGCTGGTCGAGCGTGTGCGCGCTGCCGGAAACGGACGCG
GAGAACGGAAGAACGCGGATCGCCGCGCCGAGCGCTTCGATCGTCGGCGCGGCGAAGAACATCGACGGGG
ATGGCGAGCCTGTGGCGGCGGTGCGCTTCGCCGAAGCGCATGCGCAGGCGTTCCCGCTCTGGCTGGATTT
GCAGCGCATCGCCGCGCGCGCGCTCGCGCGCGCGGGGGGCGACGGCGCCGATGCGCGGCGCGAAGTGGAG
ACGGCGGTTCGTGCGCTGCTTGCGCGGCTGCCGGGCCTCGACGCGCTGACGTTCGCGGACGGCACGCCGT
TCGCCGACGACGCGACGCGCGCATGGCTCGGCGAGCTTGGCGCGCCTGTTGTGGCGGCGGATGCGGTGTC
GCCGTCGTCTTTGCCGCTTTCGCCGCGACCTTCGCCGCCTGAGCGATCGTCGCCGATGGCGGGCGAACCG
GCGCGCGCGCCGGGCGATGCGTGCGGGGCGAGCGCCGACGATGCAGTGGACCGAGCGTGCGCGTTTGCCG
CGAGCGGCCAGCTCGATCTCGCGCTCCACGCGATTCAGCATGCGATCGATCGTGCGACGAGCGCCGAACA
GCGGTTGAGAGCGCGCGTGCGGTTGTGCGAGCTTGCGCGCGACCATTGGCCGCATGAGGTTCCTGAGGCG
TTCGCGCGCGGCGTGATCGAACCGATTCGGCGGCACGATTTGCTCGCATGGAATCCGGAGCTGGCGCTCG
ACGGCTTGTCGGCCGCCTATGCGCTGCTGATTCGGCGCGATCGCGAATCGGCGCACGCGAGGACGGTGCT
TGACGAGATCGCGAGCGTCGACGCGGCGCGGGCCATGCGTTTGTCGACGTGA