SecReT6
Protein ID: 126457603
SecReT6 ID185
T6SS typei3
Gene symbol-
Locus tagBURPS1106A_A0139
StrainBurkholderia pseudomallei 1106a
Repliconchromosome II [GenBank: NC_009078] [Browse all T6SS(s) in this replicon]
Location [Strand]122487..123788 [+]
Producthypothetical protein
NoteTssL
UniProt IDA3P1H2
KEGG IDbpl:BURPS1106A_A0139
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.30E-61, Aligned region: 62..268
OmpA [PF00691], Evalue: 6.50E-18, Aligned region: 21..36
OmpA [PF00691], Evalue: 6.50E-18, Aligned region: 327..425
Protein Sequence: 433 a.a.     [Download]
>gi|126457603|ref|YP_001074182.1| hypothetical protein BURPS1106A_A0139 [Burkholderia pseudomallei 1106a]
MNSGAFDEAAFDFLVSDEGGANVAADRARSAAKAAGAEPARDRIDASVNVQHRLDEVRAAANPLLEAATP
LLRMLADMPATLDTSEAVASLRTLLVREVALFQNLCEKADLPWKHMAVVRYCLCTALDEAANRTRWGGGG
VWASQSLLITYEGEVDGGEKFFLLIGRMATDPQEYVDILEILYRVLGLGFEGRYSVVADGRRHLEQIRQR
LWTLITGARDAIQPELSLRWRGAEPGRLPLLRSVPAWASGALVFLLLFGLFAFYQYRLLTERNALEARIL
AIAKDEPAPPPQRLRLSILLKNEIARGLLTVDEDDRRSVVVFRGDSMFRSGESRVLPEIEPVLDKVAREV
ARVGGRVTVTGHSDNQPIRRADIPNNLVLSEKRAAYVAQILVQRGTPADRIRSEGRGDAQPVAENATPAG
RSRNRRVEIAVTL
 
Nucleotide Sequence: 1302 bp     [Download]
>gi|126455463|ref|NC_009078.1|:122487-123788 Burkholderia pseudomallei 1106a chromosome II, complete sequence
ATGAATTCGGGCGCCTTTGACGAAGCCGCGTTCGATTTTCTCGTATCGGACGAAGGCGGAGCGAACGTCG
CGGCCGATCGCGCGCGATCGGCCGCGAAGGCCGCGGGCGCGGAGCCGGCGCGCGATCGGATCGACGCGTC
GGTCAACGTCCAGCATCGCCTCGACGAAGTTCGCGCGGCGGCCAATCCGCTGCTCGAAGCCGCGACGCCT
TTGCTGCGGATGCTGGCGGACATGCCTGCGACGCTAGACACCTCCGAAGCCGTCGCGAGCCTTCGCACGC
TGCTCGTGCGAGAGGTCGCGCTGTTCCAGAACTTGTGCGAGAAGGCCGATTTGCCTTGGAAGCACATGGC
GGTCGTGCGTTATTGCCTGTGCACGGCACTGGACGAGGCGGCCAATCGCACGCGCTGGGGCGGCGGCGGC
GTATGGGCTTCGCAGAGCTTGCTGATTACATACGAAGGCGAGGTCGACGGAGGCGAGAAGTTCTTCCTGT
TGATCGGACGCATGGCGACGGATCCTCAGGAGTACGTCGATATTCTCGAGATTCTCTATCGCGTGCTGGG
TCTCGGGTTCGAAGGGCGCTACAGCGTCGTTGCGGACGGCCGGCGGCATCTCGAGCAGATTCGCCAGCGT
TTGTGGACGCTCATCACCGGCGCGCGCGACGCGATTCAGCCGGAATTGTCGCTGCGCTGGCGCGGAGCGG
AGCCGGGCAGGCTTCCGCTATTGCGCAGCGTGCCCGCATGGGCGAGCGGTGCGCTCGTCTTCCTGCTGTT
GTTCGGTCTCTTCGCGTTCTATCAGTATCGGTTGCTCACCGAACGCAATGCGCTCGAGGCGCGCATCCTG
GCGATCGCGAAGGACGAGCCGGCGCCGCCACCGCAGCGTTTGCGCCTGTCGATCCTGCTCAAGAACGAAA
TTGCGCGCGGTCTACTGACGGTCGACGAAGACGATAGGCGCAGCGTGGTCGTGTTCCGTGGCGATTCGAT
GTTCCGCTCCGGCGAGAGCCGCGTGCTTCCCGAGATCGAGCCGGTGCTCGACAAGGTGGCGCGGGAAGTG
GCCCGCGTCGGCGGCCGGGTCACGGTCACGGGGCACTCCGACAACCAGCCGATTCGGCGCGCCGACATCC
CGAACAACCTCGTGTTGTCGGAAAAACGCGCGGCTTACGTCGCGCAAATCCTGGTCCAGCGAGGCACTCC
GGCCGATCGTATTCGCTCGGAGGGCCGGGGCGACGCGCAGCCCGTCGCGGAAAACGCGACGCCTGCTGGC
CGATCCCGCAACCGCCGCGTCGAAATCGCGGTCACGCTGTAA