SecReT6
Protein ID: 126457633
SecReT6 ID189
T6SS typei3
Gene symbol-
Locus tagBURPS1106A_A2830
StrainBurkholderia pseudomallei 1106a
Repliconchromosome II [GenBank: NC_009078] [Browse all T6SS(s) in this replicon]
Location [Strand]2773165..2774610 [-]
Producthypothetical protein
NoteTssG
UniProt IDA3P949
KEGG IDbpl:BURPS1106A_A2830
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 8.50E-130, Aligned region: 85..439
Protein Sequence: 481 a.a.     [Download]
>gi|126457633|ref|YP_001076859.1| hypothetical protein BURPS1106A_A2830 [Burkholderia pseudomallei 1106a]
MTTNPKPEPAGVDAGSHANSNAGRRAGAAANVEANAEPDAMPNALRGAAADVAPSAAPSATPNATPSATS
QAAAARRDAWWRRLRAAPHGYDLFHALRWLDALSPEHAPSGYASRPRDEPVRFGQAPSLAFAAAMLADVR
DDGPRPRVAIHGFGLFGPNGPLPSHLTEYAYERATQHDDPTFAAFADLFHHRLILLFYRAWADAQPTVSL
DRPARARFDRYVASLIGPCDALLADSPRGSRPDSSFASSSDSLPDSPPDSSPDSRSDSRSDSPSDAHLDP
HPDSPRGAGALAPHAKYHQAGHLVRHTRNPEGLVQILRRYFGVRVRIVEHVPHWVMLDRAQRCAIRATRP
TQPLGGAVLGRAVRDAQSRFRIVLGPLTLDEYRQFLPGGVHARQLAQWVREYVGIEFDWDVQLELARGEV
PTLALGSRHGLGRTAWLGERLGPGPARDLVLGYDERMRASRARSGAADQAAAAGAFDRQPA
 
Nucleotide Sequence: 1446 bp     [Download]
>gi|126455463|ref|NC_009078.1|:c2774610-2773165 Burkholderia pseudomallei 1106a chromosome II, complete sequence
ATGACGACGAACCCGAAACCGGAGCCCGCCGGCGTGGACGCGGGCTCGCACGCGAACTCGAATGCGGGCC
GGCGCGCCGGTGCGGCCGCGAATGTGGAGGCGAACGCGGAGCCGGACGCGATGCCGAATGCGCTCCGGGG
CGCGGCTGCGGATGTCGCGCCAAGCGCGGCGCCGAGCGCGACGCCAAATGCAACGCCGAGCGCGACGTCG
CAGGCCGCCGCCGCGCGCCGCGACGCATGGTGGCGCCGCCTGCGCGCCGCGCCGCACGGCTACGACCTGT
TTCATGCGCTGCGTTGGCTCGATGCGCTGTCGCCCGAGCACGCGCCGTCCGGCTACGCGTCGCGGCCGCG
CGACGAGCCGGTGCGCTTCGGCCAGGCGCCGTCGCTCGCGTTCGCGGCCGCGATGCTCGCCGACGTGCGT
GACGACGGCCCGCGCCCGCGCGTCGCGATTCACGGCTTCGGGCTGTTCGGGCCGAACGGGCCGCTGCCGT
CGCATCTGACCGAGTACGCATACGAGCGCGCGACGCAGCATGACGATCCGACCTTCGCCGCGTTCGCCGA
CCTGTTTCATCATCGGCTGATCCTGCTGTTCTATCGCGCATGGGCCGATGCGCAGCCGACCGTCAGCCTC
GATCGGCCGGCGCGCGCGCGGTTCGACCGCTACGTGGCCAGCCTGATCGGGCCGTGCGACGCGTTGCTTG
CCGATTCACCGCGCGGCTCACGGCCCGATTCGTCCTTCGCTTCGTCGTCCGATTCACTGCCTGATTCACC
GCCTGATTCATCGCCTGATTCGCGGTCTGATTCGCGGTCCGATTCCCCGTCCGATGCGCACCTCGATCCG
CATCCCGACTCGCCGCGCGGCGCTGGCGCGCTCGCGCCGCACGCGAAGTATCACCAGGCCGGCCATCTGG
TGCGGCACACGCGCAACCCGGAGGGGCTCGTGCAGATCCTGCGGCGCTATTTCGGTGTGCGGGTACGCAT
CGTCGAGCACGTGCCGCACTGGGTGATGCTCGATCGCGCGCAGCGCTGCGCGATCCGCGCGACGCGGCCG
ACGCAGCCGCTCGGCGGCGCCGTGCTCGGCCGTGCGGTGCGCGACGCGCAGTCGCGCTTCCGGATCGTGC
TCGGCCCGCTGACGCTCGACGAATACCGGCAGTTCCTGCCGGGCGGCGTCCATGCGCGGCAGCTCGCGCA
ATGGGTGCGCGAATACGTCGGCATCGAATTCGACTGGGACGTGCAGCTCGAGCTCGCGCGCGGCGAAGTG
CCGACGCTCGCGCTCGGCAGCCGTCACGGGCTCGGCCGCACCGCATGGCTCGGCGAGCGGCTCGGCCCCG
GCCCCGCGCGCGACCTCGTGCTCGGCTACGACGAGCGCATGCGCGCTTCGCGCGCACGATCGGGCGCGGC
CGATCAGGCGGCCGCCGCCGGTGCGTTTGATCGCCAACCTGCCTGA