SecReT6
Protein ID: 126457683
SecReT6 ID187
T6SS typei3
Gene symbol-
Locus tagBURPS1106A_A0700
StrainBurkholderia pseudomallei 1106a
Repliconchromosome II [GenBank: NC_009078] [Browse all T6SS(s) in this replicon]
Location [Strand]684134..684682 [+]
Producthypothetical protein
NoteTssB
UniProt IDA3P326
KEGG IDbpl:BURPS1106A_A0700
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.30E-54, Aligned region: 11..159
Protein Sequence: 182 a.a.     [Download]
>gi|126457683|ref|YP_001074736.1| hypothetical protein BURPS1106A_A0700 [Burkholderia pseudomallei 1106a]
MVRQKDGQKFIGESRAPRVQIEYDVEVYGSQKKVELPFVAGVMADLSGDNVEPLGPVEDRRFQEIDVENF
DERMAQIAPSLSYHVKNVLTNDGTLIPIDLTFTSMESFEPADVVKRIPELSTLLEARNRLKELLTYMDGK
AAAEDVIQELLKSPQWANEADAAEQSGGAGEGGDHQPEEGAK
 
Nucleotide Sequence: 549 bp     [Download]
>gi|126455463|ref|NC_009078.1|:684134-684682 Burkholderia pseudomallei 1106a chromosome II, complete sequence
ATGGTTCGACAAAAGGATGGACAGAAATTCATCGGGGAGAGTCGTGCGCCCCGCGTGCAGATTGAATACG
ACGTGGAGGTGTACGGCTCGCAGAAGAAGGTCGAGCTGCCGTTCGTCGCGGGCGTGATGGCGGACCTGTC
GGGCGACAACGTCGAGCCGCTCGGCCCGGTCGAGGATCGGCGCTTTCAGGAGATCGACGTCGAGAACTTC
GATGAGCGCATGGCGCAGATCGCGCCGTCGCTGAGCTATCACGTGAAGAACGTGCTGACCAACGACGGCA
CGCTGATTCCGATCGATCTGACGTTCACGTCGATGGAATCGTTCGAGCCGGCGGACGTCGTCAAGCGCAT
TCCCGAGCTGTCGACGCTGCTCGAGGCGCGCAACCGGCTGAAGGAGCTGCTGACCTACATGGACGGCAAG
GCGGCGGCCGAGGACGTGATCCAGGAATTGTTGAAGAGCCCGCAGTGGGCGAACGAGGCCGACGCGGCGG
AGCAATCCGGCGGCGCCGGCGAGGGTGGAGACCATCAACCGGAAGAGGGTGCGAAATGA