SecReT6
Protein ID: 126457919
SecReT6 ID185
T6SS typei3
Gene symbol-
Locus tagBURPS1106A_A0134
StrainBurkholderia pseudomallei 1106a
Repliconchromosome II [GenBank: NC_009078] [Browse all T6SS(s) in this replicon]
Location [Strand]118284..119783 [+]
Producthypothetical protein
NoteTssC
UniProt IDA3P1G7
KEGG IDbpl:BURPS1106A_A0134
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.60E-196, Aligned region: 66..493
Protein Sequence: 499 a.a.     [Download]
>gi|126457919|ref|YP_001074177.1| hypothetical protein BURPS1106A_A0134 [Burkholderia pseudomallei 1106a]
MAARESQARSADAQLATHSDFNALLSREFKPKTEQAREAVEHAVKTLAEQALANSVTLSDDAYKSIEAII
GEIDRKLSEQINLILHHDDFQQLESAWRGLHHLVTNTETDEKLKIRFMDVSKDDLRRTMKRYKGVAWDQS
PFFKQIYEEEYGQLGGEPYGCLVADYYFDHTPPDVDLLSSIGKVAAAAHAPFITGASPSVLQMDSWQELA
NPRDLTKIFTQNLEYAPWNSLRNSEDARYIGLAMPRFLARLPYGIRTNPVDEFDFEESTDGSDHRKYVWA
NAAYAMAVNINRSFKHYGWCTLIRGVESGGVVENLPCHTFPTDDGGIDMKCPTEIAISDRREAELAKNGF
IPLIHRKNTDYAAFIGAQSLQKPAEYYDPDATANANLSARLPYLFACSRFAHYLKCIVRDKIGSFKERED
MQQWLNEWIMNYVDADPANSSQETKARRPLAAAEVVVEDVEGNPGYYQAKFFLRPHFQLEGLTVSLRLVA
KLPSVKEAA
 
Nucleotide Sequence: 1500 bp     [Download]
>gi|126455463|ref|NC_009078.1|:118284-119783 Burkholderia pseudomallei 1106a chromosome II, complete sequence
ATGGCTGCACGTGAATCTCAGGCGCGCTCCGCCGATGCACAGCTCGCTACGCACTCGGACTTCAATGCCC
TGCTGTCGCGCGAGTTCAAACCGAAGACCGAACAGGCGCGCGAGGCGGTGGAACATGCCGTCAAGACGCT
GGCCGAGCAGGCGCTCGCCAATTCTGTGACGTTGTCGGACGACGCGTACAAGAGCATCGAAGCGATCATC
GGCGAAATCGATCGAAAGCTGTCCGAGCAGATCAACCTGATTCTGCATCACGACGATTTCCAGCAGCTGG
AAAGCGCATGGCGCGGCCTGCATCATCTGGTGACGAATACCGAGACGGACGAGAAGCTCAAGATCCGCTT
CATGGACGTCTCCAAAGACGATCTGCGCCGTACGATGAAGCGATACAAAGGCGTGGCCTGGGACCAGAGC
CCGTTTTTCAAGCAGATCTACGAAGAGGAATACGGTCAGCTCGGCGGCGAGCCGTATGGATGCCTCGTGG
CCGACTACTACTTCGACCACACGCCGCCGGACGTCGATCTGCTTTCGTCGATCGGCAAGGTGGCGGCTGC
CGCGCACGCTCCGTTCATTACCGGCGCATCGCCTTCGGTACTCCAGATGGATTCCTGGCAAGAGCTGGCC
AATCCGCGCGACCTGACGAAGATCTTCACGCAGAACCTCGAATATGCGCCCTGGAATTCGCTGCGCAATT
CCGAAGATGCCCGTTATATCGGTCTTGCGATGCCGCGCTTCCTCGCACGCTTGCCGTATGGAATCAGGAC
GAATCCCGTCGACGAATTCGATTTCGAGGAATCGACGGATGGGTCCGATCATCGCAAGTACGTGTGGGCG
AATGCCGCGTATGCGATGGCGGTCAACATCAATCGCTCGTTCAAGCATTACGGCTGGTGCACGCTGATTC
GCGGTGTGGAAAGCGGCGGCGTCGTCGAGAACCTGCCTTGCCATACGTTCCCGACGGACGACGGCGGCAT
CGACATGAAGTGTCCGACCGAAATCGCGATTTCCGATCGCCGCGAAGCGGAGCTCGCGAAGAACGGCTTC
ATTCCGCTGATCCATCGAAAGAACACCGACTACGCGGCATTCATCGGAGCGCAATCGCTGCAGAAGCCGG
CCGAGTACTACGACCCGGACGCCACCGCGAACGCGAACCTGTCCGCCCGCCTGCCGTACCTGTTCGCGTG
CTCGCGCTTCGCGCATTACCTGAAGTGCATCGTGCGCGACAAGATCGGTTCGTTCAAGGAGCGCGAAGAC
ATGCAGCAGTGGCTCAACGAATGGATCATGAACTATGTCGACGCCGACCCGGCGAACTCGTCGCAGGAGA
CCAAGGCGCGCCGTCCGCTGGCCGCGGCCGAAGTGGTTGTCGAAGACGTGGAAGGCAATCCGGGCTACTA
CCAGGCGAAGTTCTTCCTGCGTCCGCACTTCCAGCTGGAAGGGTTGACCGTGTCGCTGCGCCTCGTCGCG
AAGCTGCCCTCGGTCAAGGAAGCGGCGTAA