SecReT6
Protein ID: 126457921
SecReT6 ID189
T6SS typei3
Gene symbol-
Locus tagBURPS1106A_A2835
StrainBurkholderia pseudomallei 1106a
Repliconchromosome II [GenBank: NC_009078] [Browse all T6SS(s) in this replicon]
Location [Strand]2779102..2779680 [-]
Producthypothetical protein
NoteTssB
UniProt IDA3P954
KEGG IDbpl:BURPS1106A_A2835
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 3.00E-58, Aligned region: 15..166
Protein Sequence: 192 a.a.     [Download]
>gi|126457921|ref|YP_001076864.1| hypothetical protein BURPS1106A_A2835 [Burkholderia pseudomallei 1106a]
MTSKYKASASGQKFIARNRAPRVQIEYDVETYGAERKVQLPFVMGVIADLAGKRAEPLPDLPERKFLEID
VDNFDERMKSIAPRVAFQVPNTLSGDGMLSVDMTFESIDDFSPAAIARNVDALRRLLDARTELSNLLSYM
DGKHGAEQLIENAINDPALLASLVRQPLAADAEGGARQPVTGTEDDPEIRHE
 
Nucleotide Sequence: 579 bp     [Download]
>gi|126455463|ref|NC_009078.1|:c2779680-2779102 Burkholderia pseudomallei 1106a chromosome II, complete sequence
ATGACGAGCAAGTACAAGGCTTCGGCCAGCGGACAGAAATTCATCGCGCGCAACCGCGCGCCGCGCGTGC
AGATCGAGTACGACGTCGAGACCTACGGCGCCGAGCGCAAGGTCCAACTGCCGTTCGTGATGGGCGTGAT
CGCGGATCTCGCGGGCAAGCGGGCCGAGCCGCTGCCGGACTTGCCGGAGCGCAAGTTCCTCGAAATCGAC
GTCGACAATTTCGACGAGCGGATGAAATCGATCGCGCCGCGCGTCGCGTTCCAGGTGCCGAACACGCTGT
CGGGAGACGGCATGCTGAGCGTCGACATGACGTTCGAGAGCATCGACGATTTCTCGCCCGCCGCGATCGC
GCGCAACGTCGACGCGTTGCGGCGCCTGCTCGACGCGCGCACCGAGCTGTCGAACCTGCTGTCGTACATG
GACGGCAAGCACGGCGCCGAGCAACTGATCGAAAACGCGATCAACGATCCGGCACTGCTGGCCTCGCTCG
TGCGGCAGCCGCTCGCGGCGGACGCCGAAGGCGGCGCGCGGCAGCCCGTGACCGGCACCGAAGACGACCC
GGAGATTCGCCATGAATGA