SecReT6
Protein ID: 126457957
SecReT6 ID187
T6SS typei3
Gene symbol-
Locus tagBURPS1106A_A0716
StrainBurkholderia pseudomallei 1106a
Repliconchromosome II [GenBank: NC_009078] [Browse all T6SS(s) in this replicon]
Location [Strand]704324..705982 [+]
Producthypothetical protein
NoteTssL
UniProt IDA3P342
KEGG IDbpl:BURPS1106A_A0716
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.60E-43, Aligned region: 122..317
OmpA [PF00691], Evalue: 5.00E-10, Aligned region: 376..483
Protein Sequence: 552 a.a.     [Download]
>gi|126457957|ref|YP_001074752.1| hypothetical protein BURPS1106A_A0716 [Burkholderia pseudomallei 1106a]
MLDRAAANPDLVTRVPTLSSLSSAAMTSSAVSTTGTTNTVASGGAAAGAPSFAPPAADAFPQADGAPRNP
AVLQFPVPGGAPAPADARVAAPVVYSAQGEQAAIMKAGLQQASWNNPFVSHALPAVLQLQRHLAAGPLNQ
AAIRTQLGLEVRLYRERLAASGCEWEQIRDASYLLCTYLDETVNDAAREHAQVVYDGERSLLVEFHDDAW
GGEDAFADLSRWMKTEPPPIPLLSFYELILSLGWQGRYRVLDRGDVLLQDLRSQLHALIWHHVPPEPLGT
ELVAPAKRRRSWWTAGRAAAVALGVLVLAYGAISFWLDSQGRPIRNALAAWMPPTRTINIAETLPPPLPQ
ILTEGWLTAYKHPQGWLLVFKSDGAFDVGKANVRADFMHNIERLGLAFAPWPGDLEVIGHTDSRPIRTSE
FPDNQALSEARARNVADELRKTALPGGARAPENAVQRNIEYSGRGDAQPIDTAKTAAAYERNRRVDVLWK
VIPDGAQQSGRSLNLQQPEKPGQVPMRPAMPEGVEIAPDGQLPYATSTTMPATRPTTEGRQP
 
Nucleotide Sequence: 1659 bp     [Download]
>gi|126455463|ref|NC_009078.1|:704324-705982 Burkholderia pseudomallei 1106a chromosome II, complete sequence
ATGCTCGATCGCGCGGCGGCGAATCCGGATCTCGTGACGCGCGTGCCGACGCTGTCGTCGCTGTCGAGCG
CGGCGATGACGAGCTCCGCCGTATCGACCACCGGCACGACGAACACGGTGGCGTCGGGCGGCGCGGCCGC
GGGCGCGCCGAGCTTCGCGCCGCCGGCCGCCGACGCGTTTCCCCAAGCCGACGGCGCGCCCCGCAACCCC
GCGGTGCTGCAATTCCCGGTGCCGGGCGGCGCGCCCGCGCCCGCCGACGCGCGGGTGGCCGCGCCCGTCG
TCTACAGCGCGCAGGGCGAGCAGGCCGCGATCATGAAAGCAGGCCTGCAGCAGGCGAGCTGGAACAACCC
GTTCGTGTCGCACGCGCTGCCCGCGGTGCTGCAACTGCAGCGCCACCTCGCGGCCGGCCCGCTCAATCAG
GCCGCGATCCGCACGCAGCTCGGCCTCGAGGTGCGGCTCTACCGCGAGCGGCTCGCCGCCTCCGGCTGCG
AATGGGAGCAGATCCGCGACGCGTCGTACCTGCTCTGCACGTATCTCGACGAAACCGTCAACGACGCGGC
GCGCGAGCACGCGCAAGTCGTCTACGACGGCGAGCGCAGCCTGCTCGTCGAATTCCACGACGACGCGTGG
GGCGGCGAGGACGCGTTCGCCGACCTGTCGCGCTGGATGAAGACCGAGCCGCCGCCGATTCCGCTTCTGT
CGTTCTACGAACTGATCCTGTCGCTCGGCTGGCAGGGCCGCTACCGCGTGCTCGACCGCGGCGACGTGCT
GCTGCAGGATCTGCGCTCGCAACTGCACGCGCTGATCTGGCATCACGTGCCGCCCGAGCCGCTCGGCACC
GAGCTCGTCGCGCCCGCGAAGCGGCGCCGCTCGTGGTGGACGGCCGGGCGCGCGGCGGCCGTCGCGCTCG
GCGTGCTGGTGCTCGCGTACGGCGCGATCAGCTTCTGGCTCGATTCGCAGGGCCGCCCGATCCGCAACGC
GCTCGCCGCGTGGATGCCGCCCACGCGCACGATCAACATCGCCGAGACGCTGCCGCCGCCGCTGCCGCAG
ATTCTCACCGAAGGGTGGCTCACCGCGTACAAGCATCCGCAAGGATGGCTGCTCGTGTTCAAGAGCGACG
GCGCGTTCGACGTCGGCAAGGCGAACGTGCGGGCGGACTTCATGCACAACATCGAGCGGCTCGGCCTCGC
GTTCGCGCCGTGGCCGGGCGACCTCGAGGTGATCGGTCACACCGATTCGCGGCCGATCCGCACGAGCGAG
TTCCCGGACAACCAGGCGCTGTCCGAAGCGCGGGCGCGCAACGTCGCCGACGAACTGCGCAAGACCGCGC
TGCCGGGCGGCGCGCGCGCGCCGGAGAACGCGGTGCAGCGCAACATCGAGTACTCGGGGCGCGGCGACGC
GCAGCCGATCGACACCGCGAAGACGGCCGCCGCGTACGAGCGCAACCGCCGCGTCGACGTGCTGTGGAAG
GTGATTCCCGACGGCGCGCAGCAATCGGGCCGCAGCCTGAACCTGCAGCAGCCGGAGAAGCCCGGGCAGG
TGCCGATGCGTCCGGCGATGCCGGAGGGCGTGGAGATCGCGCCTGACGGGCAACTGCCGTATGCGACGTC
AACCACGATGCCAGCAACGAGACCGACCACGGAGGGCCGTCAGCCATGA