SecReT6
Protein ID: 126458585
SecReT6 ID188
T6SS typei1
Gene symbol-
Locus tagBURPS1106A_A2030
StrainBurkholderia pseudomallei 1106a
Repliconchromosome II [GenBank: NC_009078] [Browse all T6SS(s) in this replicon]
Location [Strand]1997865..1998911 [+]
Producthypothetical protein
NoteTssG
UniProt IDA3P6V3
KEGG IDbpl:BURPS1106A_A2030
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 9.80E-81, Aligned region: 19..319
Protein Sequence: 348 a.a.     [Download]
>gi|126458585|ref|YP_001076063.1| hypothetical protein BURPS1106A_A2030 [Burkholderia pseudomallei 1106a]
MAAANGGAMPALEPVLLGEAKHFAYFQAIRLLRRIARERRGDAAGRPDAPLPIHTRPNLSLSFPDTDVER
IDKADDGGYRVVANFFGLYGVSSPLPTFYTEDLIDEAFRGRHAARGFLDVLHRALYPLLFDAWLKHRLAL
RIVEERDEHALRPLYALAGVDARIARDAGLHEHALLRYVGLLSQRPRSAAGLRALLADAFAPATVDIEPC
VPQWLPIPDDQRTRVGTRARRLGADARVGARMRDDGARLRIVLGDVPGPLFRALMPGGDAFARLRLLVRL
YLTQPFAVDVVVRVRARDAAPARCGRRAWSRVGLDAWLGGPSAERAASPEFRLPTSLFDQARPHHAAG
 
Nucleotide Sequence: 1047 bp     [Download]
>gi|126455463|ref|NC_009078.1|:1997865-1998911 Burkholderia pseudomallei 1106a chromosome II, complete sequence
GTGGCCGCCGCGAATGGGGGCGCAATGCCTGCTCTAGAACCCGTTCTGCTCGGCGAGGCGAAGCACTTCG
CGTATTTCCAGGCGATCCGGCTGCTGCGGCGCATCGCGCGCGAACGGCGCGGCGACGCCGCGGGGCGGCC
CGACGCGCCGCTGCCGATCCACACGCGGCCGAATCTCTCGCTGTCGTTTCCGGACACCGACGTCGAGCGC
ATCGACAAGGCCGACGACGGCGGCTACCGGGTCGTCGCGAACTTCTTCGGTCTGTACGGCGTGTCCTCGC
CGCTGCCGACGTTCTACACCGAGGACCTGATCGACGAAGCGTTCAGGGGCCGCCACGCGGCGCGCGGCTT
TCTCGACGTGCTGCATCGCGCGCTCTATCCGCTGCTGTTCGACGCGTGGCTCAAGCATCGGCTGGCGCTG
CGGATCGTCGAGGAACGCGACGAGCACGCGCTGCGCCCGCTCTACGCACTCGCGGGCGTCGACGCGCGCA
TCGCGCGCGACGCGGGCCTGCACGAGCACGCGCTGCTGCGCTACGTCGGGCTGCTCAGCCAGCGGCCGCG
CTCCGCGGCCGGTCTGCGCGCGCTGCTCGCCGACGCGTTCGCGCCCGCGACGGTCGACATCGAGCCGTGC
GTGCCGCAATGGCTGCCGATTCCGGACGACCAGCGCACCCGCGTCGGCACGCGCGCGCGCCGGCTCGGCG
CCGACGCGCGGGTCGGCGCGCGCATGCGCGACGACGGCGCCCGGCTGCGGATCGTGCTCGGCGACGTGCC
CGGCCCGCTGTTCCGCGCGCTGATGCCGGGCGGCGATGCGTTTGCCCGGCTGCGCTTGCTCGTACGCCTG
TATCTGACCCAACCGTTCGCCGTGGACGTCGTGGTGCGCGTGCGCGCGCGCGACGCGGCCCCCGCGCGCT
GCGGCCGCCGCGCGTGGTCGCGCGTCGGGCTCGACGCGTGGCTGGGCGGCCCGAGCGCGGAACGCGCGGC
GTCGCCCGAATTCCGTCTTCCGACTTCCCTCTTTGATCAAGCGAGACCCCATCATGCTGCTGGTTGA