SecReT6
Protein ID: 126463877
SecReT6 ID177
T6SS typei3
Gene symbol-
Locus tagRsph17029_3118
StrainRhodobacter sphaeroides ATCC 17029
Repliconchromosome II [GenBank: NC_009050] [Browse all T6SS(s) in this replicon]
Location [Strand]131247..133916 [-]
ProductATPase
NoteTssH
UniProt IDA3PPF2
KEGG IDrsh:Rsph17029_3118
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 6.70E-39, Aligned region: 224..242
AAA_2 [PF07724], Evalue: 6.70E-39, Aligned region: 621..780
AAA [PF00004], Evalue: 2.50E-20, Aligned region: 224..357
AAA [PF00004], Evalue: 2.50E-20, Aligned region: 626..717
AAA_16 [PF13191], Evalue: 4.70E-15, Aligned region: 201..246
AAA_16 [PF13191], Evalue: 4.70E-15, Aligned region: 269..302
AAA_16 [PF13191], Evalue: 4.70E-15, Aligned region: 476..552
AAA_16 [PF13191], Evalue: 4.70E-15, Aligned region: 593..670
AAA_16 [PF13191], Evalue: 4.70E-15, Aligned region: 689..708
AAA_16 [PF13191], Evalue: 4.70E-15, Aligned region: 747..813
AAA_5 [PF07728], Evalue: 2.20E-13, Aligned region: 224..244
AAA_5 [PF07728], Evalue: 2.20E-13, Aligned region: 322..354
AAA_5 [PF07728], Evalue: 2.20E-13, Aligned region: 625..744
ClpB_D2-small [PF10431], Evalue: 2.40E-11, Aligned region: 788..862
AAA_22 [PF13401], Evalue: 2.40E-10, Aligned region: 223..305
AAA_22 [PF13401], Evalue: 2.40E-10, Aligned region: 331..384
AAA_22 [PF13401], Evalue: 2.40E-10, Aligned region: 623..660
Sigma54_activat [PF00158], Evalue: 1.10E-07, Aligned region: 205..239
Sigma54_activat [PF00158], Evalue: 1.10E-07, Aligned region: 597..726
IstB_IS21 [PF01695], Evalue: 4.20E-06, Aligned region: 210..255
IstB_IS21 [PF01695], Evalue: 4.20E-06, Aligned region: 625..645
AAA_25 [PF13481], Evalue: 1.80E-05, Aligned region: 206..251
AAA_25 [PF13481], Evalue: 1.80E-05, Aligned region: 623..654
AAA_17 [PF13207], Evalue: 1.80E-05, Aligned region: 224..265
AAA_17 [PF13207], Evalue: 1.80E-05, Aligned region: 624..660
Clp_N [PF02861], Evalue: 5.40E-05, Aligned region: 29..78
Clp_N [PF02861], Evalue: 5.40E-05, Aligned region: 111..136
NACHT [PF05729], Evalue: 6.20E-05, Aligned region: 224..251
NACHT [PF05729], Evalue: 6.20E-05, Aligned region: 625..652
AAA_18 [PF13238], Evalue: 9.90E-05, Aligned region: 224..247
AAA_18 [PF13238], Evalue: 9.90E-05, Aligned region: 626..654
AAA_14 [PF13173], Evalue: 0.00017, Aligned region: 224..304
AAA_14 [PF13173], Evalue: 0.00017, Aligned region: 624..706
Arch_ATPase [PF01637], Evalue: 0.00022, Aligned region: 202..238
Arch_ATPase [PF01637], Evalue: 0.00022, Aligned region: 276..308
Arch_ATPase [PF01637], Evalue: 0.00022, Aligned region: 624..665
Zeta_toxin [PF06414], Evalue: 0.00025, Aligned region: 224..245
Zeta_toxin [PF06414], Evalue: 0.00025, Aligned region: 617..665
TIP49 [PF06068], Evalue: 0.0022, Aligned region: 224..245
TIP49 [PF06068], Evalue: 0.0022, Aligned region: 272..304
TIP49 [PF06068], Evalue: 0.0022, Aligned region: 594..661
RNA_helicase [PF00910], Evalue: 0.0022, Aligned region: 225..245
RNA_helicase [PF00910], Evalue: 0.0022, Aligned region: 626..647
RNA_helicase [PF00910], Evalue: 0.0022, Aligned region: 723..744
AAA_29 [PF13555], Evalue: 0.0033, Aligned region: 216..240
AAA_29 [PF13555], Evalue: 0.0033, Aligned region: 623..636
Hpr_kinase_C [PF07475], Evalue: 0.0033, Aligned region: 224..236
Hpr_kinase_C [PF07475], Evalue: 0.0033, Aligned region: 623..647
RuvB_N [PF05496], Evalue: 0.0055, Aligned region: 223..239
RuvB_N [PF05496], Evalue: 0.0055, Aligned region: 280..304
RuvB_N [PF05496], Evalue: 0.0055, Aligned region: 594..647
RuvB_N [PF05496], Evalue: 0.0055, Aligned region: 693..724
Protein Sequence: 889 a.a.     [Download]
>gi|126463877|ref|YP_001044990.1| ATPase [Rhodobacter sphaeroides ATCC 17029]
MPRGSQETVKRKELVAKLNPTCLAAFSAAAQAAKARGNPYVELVHLIEALLAADRSDMALLMRAAGCDAG
RLSADVARAVDVLPRGASAVEEFSDHLFHAIREGWTFGSLRFGDDRVRSGYLLLGALRVPVLEALLMRIS
GAFGQVDAESLSETFRDLTQGSAEGDAAPPPARPGAADGSALARYATDLTARAREGRLDPVVGRDPEIRQ
IIDILMRRRQNNPILTGEAGVGKTAVVEGLALRLARGDVPPPLRTVTLWMLDLGLMQAGASMKGEFEKRL
KSVIDEIQASDAPVILFIDEAHTLIGAGGAAGTGDAANLLKPALARGELRTVAATTWAEYKQHIEPDPAL
TRRFQVVRIEEPSEEAAIRMCRGVAAVLERHHRVEILDEAVGAAVRLSHRYLPARQLPDKAISLLDTACA
RVAVSQHATPAEVEDIDRRAQALEIEAGILEREEAVGMDVTARRGDVEAARTAVAADRAAAETRWEAEKA
LVAEILELRARLRAEGDALDGTPPQAAEEAEPPRDDRAALLDRLRRCSRDLAEAQGERPLILPTVDRQAV
ASVVQDWTGIPMGRMLASRNERALGLADLLARRVVGQDHAMEAIASRIRTAQAGLGPPEKPLGVFLLCGP
SGVGKTETALALAEQLHGGEQALITINMSEFQEAHTVSTLKGSPPGYVGYGKGGILTEAVRRKPYSVILL
DEVEKAHPDVHEIFFQVFDKGRMDDSEGRQIDFRNTVILLTSNVGTDEIVEAAGQDLAEVSAALRAPLLQ
VFPAALLGRMIVLPFLPLSDRMIAAIAGQKLEAIARRLKAGHGAELVLGEGVLETIRARCTEVESGGRMI
DAILSGTLLPELSRKLLERQLAGAAFSRVTLTGGPAGFSYAFETEADHA
 
Nucleotide Sequence: 2670 bp     [Download]
>gi|126463752|ref|NC_009050.1|:c133916-131247 Rhodobacter sphaeroides ATCC 17029 chromosome 2, complete sequence
ATGCCGCGGGGCTCGCAGGAAACCGTCAAGCGGAAGGAACTGGTGGCGAAGCTGAACCCGACCTGTCTCG
CGGCCTTCTCGGCGGCGGCTCAGGCGGCGAAGGCGCGCGGCAACCCCTATGTGGAGCTGGTCCATCTGAT
CGAGGCGCTGCTCGCCGCGGATCGGTCCGACATGGCGCTGCTGATGCGCGCGGCAGGCTGCGATGCCGGC
CGGCTCTCGGCCGATGTGGCCCGCGCGGTGGACGTGCTGCCACGCGGGGCGAGCGCGGTGGAAGAATTTT
CCGACCATCTCTTCCATGCCATCCGCGAGGGCTGGACCTTCGGCAGCCTGCGGTTCGGCGACGACCGCGT
GCGCTCGGGATACCTCCTGCTTGGCGCGCTGCGGGTGCCCGTGCTCGAGGCGCTGCTCATGCGGATCAGC
GGCGCCTTCGGGCAGGTGGATGCAGAGTCTCTTTCCGAGACGTTCCGCGATCTGACGCAGGGCTCGGCCG
AGGGCGATGCCGCGCCGCCCCCCGCGCGGCCGGGCGCGGCCGACGGCTCCGCGCTCGCCCGCTATGCGAC
CGATCTGACGGCGCGGGCGCGGGAGGGGCGGCTCGATCCGGTCGTGGGGCGCGATCCCGAGATCCGGCAG
ATCATCGACATCCTGATGCGGCGGAGGCAGAACAATCCGATCCTCACCGGCGAGGCCGGGGTGGGCAAGA
CCGCCGTCGTCGAGGGCCTTGCGCTGCGGCTTGCCCGCGGGGACGTGCCGCCGCCGCTGCGTACGGTGAC
CCTGTGGATGCTCGATCTCGGGCTGATGCAGGCGGGTGCCAGCATGAAGGGCGAGTTCGAGAAGCGGCTG
AAGAGCGTGATCGACGAGATTCAGGCCTCGGACGCTCCGGTGATCCTCTTCATCGACGAGGCCCATACGC
TGATCGGCGCGGGCGGCGCGGCGGGGACGGGGGACGCGGCCAATCTTCTCAAACCGGCACTGGCACGGGG
AGAGCTGCGCACCGTCGCCGCCACCACCTGGGCCGAATACAAGCAGCATATCGAGCCCGACCCGGCGCTG
ACCCGCCGCTTTCAGGTGGTGCGGATCGAGGAGCCCTCGGAAGAGGCCGCGATCCGCATGTGCCGCGGCG
TGGCCGCCGTGCTGGAGCGCCATCACCGGGTCGAGATCCTCGACGAGGCGGTGGGGGCGGCGGTGCGGCT
GTCGCATCGCTACCTGCCGGCCAGGCAATTGCCGGACAAGGCGATTTCCCTGCTCGACACCGCCTGCGCA
CGCGTCGCCGTCTCGCAGCATGCGACGCCGGCGGAGGTCGAGGACATCGACCGCCGCGCGCAGGCGCTCG
AGATCGAGGCGGGCATCCTCGAGCGCGAGGAGGCCGTGGGCATGGATGTGACGGCGCGCCGCGGCGACGT
CGAGGCGGCGCGGACCGCCGTCGCGGCCGACCGGGCTGCGGCGGAGACGCGCTGGGAGGCCGAGAAGGCG
CTGGTGGCCGAAATTCTCGAGTTGCGCGCCCGGCTGCGGGCAGAGGGCGATGCGCTGGACGGCACACCGC
CGCAGGCCGCCGAGGAGGCCGAGCCGCCCAGGGACGACCGTGCGGCCCTCCTCGACCGCCTGCGGCGTTG
CAGCCGGGATCTCGCCGAGGCGCAGGGGGAGCGGCCGCTGATCCTGCCGACGGTCGACCGTCAGGCGGTC
GCCTCGGTGGTGCAGGACTGGACCGGCATCCCGATGGGGCGGATGCTGGCCAGCCGCAACGAACGCGCGC
TCGGCCTTGCGGACCTGCTGGCCCGGCGTGTCGTGGGACAGGATCATGCGATGGAGGCCATCGCGAGCCG
GATCCGGACCGCGCAGGCGGGGCTCGGGCCGCCGGAGAAGCCGCTCGGGGTCTTCCTGCTCTGCGGACCC
TCGGGCGTCGGCAAGACCGAGACGGCGCTGGCCTTGGCCGAACAGCTGCACGGTGGCGAGCAGGCTCTCA
TCACGATCAACATGAGCGAGTTTCAGGAGGCGCACACGGTCTCGACGCTGAAGGGCTCGCCCCCGGGCTA
TGTGGGCTATGGCAAGGGCGGCATCCTGACGGAGGCGGTGCGGCGAAAACCCTATTCGGTGATCCTGCTC
GACGAGGTCGAGAAGGCGCATCCCGACGTCCATGAAATATTCTTTCAGGTGTTCGACAAGGGAAGGATGG
ACGACAGCGAAGGGCGGCAGATCGATTTCCGCAATACGGTGATCCTGCTGACCTCGAACGTCGGCACCGA
CGAGATCGTGGAGGCTGCGGGGCAGGATCTGGCAGAAGTGTCGGCCGCCCTCCGCGCGCCGCTTCTACAG
GTCTTTCCGGCCGCGCTGCTGGGGCGGATGATCGTGCTGCCGTTCCTGCCGCTCTCGGACCGGATGATCG
CGGCCATCGCGGGGCAGAAGCTCGAGGCCATTGCCCGGCGGCTGAAGGCAGGGCACGGCGCCGAGTTGGT
TCTGGGCGAGGGCGTGCTCGAGACGATCCGCGCCCGCTGCACCGAGGTCGAGTCGGGCGGACGGATGATC
GATGCGATCCTGAGCGGCACCCTGCTGCCGGAACTGAGCCGCAAGCTGCTCGAGCGCCAGCTCGCGGGGG
CGGCCTTCAGCCGGGTGACCCTCACCGGCGGGCCCGCGGGCTTTTCCTATGCGTTCGAGACGGAGGCGGA
TCATGCATGA