SecReT6
Protein ID: 126463879
SecReT6 ID177
T6SS typei3
Gene symbol-
Locus tagRsph17029_3120
StrainRhodobacter sphaeroides ATCC 17029
Repliconchromosome II [GenBank: NC_009050] [Browse all T6SS(s) in this replicon]
Location [Strand]136135..137208 [+]
ProductImpA domain-containing protein
NoteTssA
UniProt IDA3PPF4
KEGG IDrsh:Rsph17029_3120
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.90E-19, Aligned region: 55..114
ImpA-rel_N [PF06812], Evalue: 2.90E-19, Aligned region: 213..229
Protein Sequence: 357 a.a.     [Download]
>gi|126463879|ref|YP_001044992.1| ImpA domain-containing protein [Rhodobacter sphaeroides ATCC 17029]
MSELREFLDPIEGDAPSGADLRNDPRFHAIERLIEPARRAARQAAAETGSQVQLDWSAIVAEARALAASG
RDLRLLVILLRALTAEEGLAGLASGLDLLARTVESYWDTLHPALREGPPQEAAMRRVNALRQIENADAGL
LGDLEFQPMFEMRALGPVTGGDLAAGGLRAAQVLAEAPRGLGARETSEIAAAHEARAARVAAACRGLKAE
RPAEFEGLAAGLAHAQAALGRLEAALAKELGTNGAGLRFTALSTQLQRMAATLGTATAEPAPLAAEAPAA
LPEAPALGIASRRDVERCLDLIIDFYERTEPSSPIPHLARRMRRMVPMNFLQLMEEVAPSGMKEFRAVAG
VADERTK
 
Nucleotide Sequence: 1074 bp     [Download]
>gi|126463752|ref|NC_009050.1|:136135-137208 Rhodobacter sphaeroides ATCC 17029 chromosome 2, complete sequence
ATGTCGGAGCTACGGGAATTTCTCGATCCGATCGAAGGCGACGCTCCGTCGGGTGCGGACCTGCGGAACG
ATCCGCGCTTTCACGCCATCGAGCGCCTCATCGAACCGGCCCGGCGCGCGGCCCGTCAGGCGGCCGCCGA
GACGGGCTCTCAGGTGCAGCTCGACTGGAGCGCCATCGTGGCCGAAGCGCGCGCGCTTGCGGCCTCGGGG
CGCGACCTCCGGCTTCTGGTGATCCTCCTGCGCGCGCTCACCGCCGAGGAGGGGCTGGCGGGGCTCGCCT
CGGGGCTCGACCTGCTGGCCCGGACGGTGGAGAGCTACTGGGACACGCTCCACCCCGCGCTGCGCGAGGG
GCCGCCGCAGGAGGCGGCCATGCGCCGGGTCAATGCGCTGCGCCAGATCGAGAATGCGGATGCGGGCCTT
CTCGGCGATCTCGAGTTCCAGCCGATGTTCGAGATGCGGGCCCTCGGCCCCGTCACGGGCGGCGACCTCG
CGGCGGGCGGCTTGCGCGCGGCGCAGGTGCTGGCCGAGGCCCCGCGCGGGCTCGGCGCGCGCGAGACCTC
CGAGATCGCCGCCGCGCACGAGGCGCGGGCCGCCCGCGTGGCTGCCGCCTGCCGCGGACTGAAGGCGGAG
CGGCCGGCGGAGTTCGAGGGCCTCGCCGCAGGGCTCGCCCATGCACAGGCGGCCCTCGGCCGGCTCGAGG
CGGCGCTGGCGAAAGAGCTCGGCACCAACGGCGCGGGGCTACGCTTCACGGCCCTCTCGACCCAGCTTCA
GCGCATGGCCGCGACCCTCGGCACCGCCACGGCAGAGCCCGCACCTCTCGCCGCAGAGGCCCCCGCCGCC
CTCCCCGAGGCCCCGGCCCTGGGGATCGCCTCGCGCCGCGATGTCGAGCGCTGCCTCGACCTCATCATCG
ATTTCTACGAGCGCACCGAGCCCTCGTCGCCGATCCCGCATCTGGCGCGGCGGATGCGGCGGATGGTGCC
GATGAACTTCCTCCAGCTCATGGAGGAGGTCGCCCCCTCGGGCATGAAGGAATTCCGCGCCGTGGCCGGC
GTCGCGGACGAGCGGACGAAATGA