SecReT6
Protein ID: 126463880
SecReT6 ID177
T6SS typei3
Gene symbol-
Locus tagRsph17029_3121
StrainRhodobacter sphaeroides ATCC 17029
Repliconchromosome II [GenBank: NC_009050] [Browse all T6SS(s) in this replicon]
Location [Strand]137227..137757 [+]
Producthypothetical protein
NoteTssB
UniProt IDA3PPF5
KEGG IDrsh:Rsph17029_3121
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.20E-53, Aligned region: 9..168
Protein Sequence: 176 a.a.     [Download]
>gi|126463880|ref|YP_001044993.1| hypothetical protein Rsph17029_3121 [Rhodobacter sphaeroides ATCC 17029]
MSESKAKVIERNRAPRVQIAYDVEHYGSPTTIELPFVMGVMADLAGKSETREAQKPAAERAFVEVDAGRF
GKFMEALSPRVKARVPNRLPGGAEGGEEEMFVDLSFRSMGDFAPDRMAEQVPALAELLRMRRQLEELLGY
MDGKVSAEKRIAQLLTNEPLLAQVAGEAVKSRQAEE
 
Nucleotide Sequence: 531 bp     [Download]
>gi|126463752|ref|NC_009050.1|:137227-137757 Rhodobacter sphaeroides ATCC 17029 chromosome 2, complete sequence
ATGAGCGAGAGCAAGGCGAAGGTGATCGAACGCAACCGCGCTCCGCGGGTGCAGATCGCCTATGACGTGG
AGCATTACGGCAGCCCGACCACCATCGAGCTGCCCTTCGTGATGGGGGTCATGGCCGACCTCGCCGGCAA
GTCCGAGACGCGCGAGGCGCAGAAGCCCGCGGCCGAGCGGGCCTTCGTCGAGGTGGATGCCGGCCGGTTC
GGCAAGTTCATGGAGGCGCTGAGCCCGCGGGTGAAGGCACGGGTCCCGAACCGGCTGCCCGGCGGGGCGG
AGGGCGGCGAGGAGGAGATGTTCGTCGATCTCAGCTTCCGCAGCATGGGCGATTTCGCCCCCGACCGCAT
GGCCGAACAGGTGCCGGCGCTGGCCGAGCTCCTGCGGATGCGGCGCCAGCTCGAAGAGCTTCTGGGCTAC
ATGGACGGCAAGGTCAGTGCCGAGAAGCGCATCGCCCAGCTTCTGACGAACGAGCCGCTGCTCGCGCAGG
TCGCGGGCGAGGCCGTGAAGTCGCGTCAGGCGGAGGAATGA