SecReT6
Protein ID: 126463881
SecReT6 ID177
T6SS typei3
Gene symbol-
Locus tagRsph17029_3122
StrainRhodobacter sphaeroides ATCC 17029
Repliconchromosome II [GenBank: NC_009050] [Browse all T6SS(s) in this replicon]
Location [Strand]137760..139271 [+]
Producthypothetical protein
NoteTssC
UniProt IDA3PPF6
KEGG IDrsh:Rsph17029_3122
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.10E-178, Aligned region: 69..498
Protein Sequence: 503 a.a.     [Download]
>gi|126463881|ref|YP_001044994.1| hypothetical protein Rsph17029_3122 [Rhodobacter sphaeroides ATCC 17029]
MAEAKQDTGPATAETEALDLGEFSALLEKDFRVREDDSDKLKELVRNLALAATERSGTATISGNAVKSIK
SLIAGIDALLSAQMNEILHAPEVRQIEGTWRGLHYLVNNTETDQKLKIRVMNITKDELADQLEDFEGQMW
DQSPTFKKLYTEEYSMFGGAPFGAVIGAYEFSHHPRDVSLLRNISGICASAHAPFIAAAAPQLFRMESWQ
ELPNPQDLQQIVSSPDYASWQSLRESEDSRYIGLTLPRVLARLPYGAATIPVKGFAFEEEIDGKHDHYVW
MNAAFPMGVNVNRSHKLYSWGTQIRGVETGGSVINLPVHTFPTDDGSVAMKCPTEIAIDDRREAELARLG
MMPILHRKNTDIAAFIGAHSLQDDEARAGRLVDPDAQSNERLSANLPYLFPVCRFAHYLKAIARDKIGSF
KERADMQVWLSEWINRYVLANTAMADDKQKARRPLAAAEVQVDSVEGRPGYYAARFYLRPHYQLEGINAS
LRLVSELPSVKGG
 
Nucleotide Sequence: 1512 bp     [Download]
>gi|126463752|ref|NC_009050.1|:137760-139271 Rhodobacter sphaeroides ATCC 17029 chromosome 2, complete sequence
ATGGCCGAAGCCAAGCAGGACACGGGCCCCGCCACCGCCGAGACCGAGGCGCTGGATCTGGGCGAGTTCA
GTGCGCTTCTGGAAAAGGATTTCCGCGTCCGCGAGGACGACAGCGACAAGCTGAAGGAGCTGGTGCGCAA
CCTCGCCCTCGCAGCCACCGAGCGGTCGGGCACCGCCACCATCTCGGGCAATGCCGTCAAGTCGATCAAG
TCGCTGATCGCGGGGATCGACGCGCTTCTTTCGGCGCAGATGAACGAGATCCTCCACGCCCCCGAGGTGC
GCCAGATCGAGGGGACATGGCGCGGGCTCCATTATCTCGTGAACAACACCGAGACCGACCAGAAGCTGAA
GATCCGTGTGATGAACATCACCAAGGACGAACTGGCCGACCAGCTCGAGGATTTCGAGGGCCAGATGTGG
GACCAGTCGCCCACCTTCAAGAAGCTCTACACCGAGGAATATTCGATGTTCGGCGGCGCGCCCTTCGGGG
CGGTCATCGGGGCCTATGAGTTCAGCCACCATCCGCGCGACGTGAGCCTCCTGCGCAACATCTCGGGCAT
CTGCGCCTCGGCCCATGCGCCCTTCATCGCCGCGGCGGCCCCACAGCTCTTCCGCATGGAGAGCTGGCAG
GAACTGCCCAATCCGCAGGATCTCCAGCAGATCGTCTCCTCGCCCGATTACGCCAGCTGGCAGTCGCTGC
GCGAGAGCGAGGACAGCCGCTACATCGGCCTCACGCTGCCGCGGGTGCTGGCCCGCCTGCCCTATGGCGC
GGCCACGATCCCGGTGAAGGGCTTCGCCTTCGAGGAGGAGATCGACGGCAAGCACGACCATTACGTCTGG
ATGAACGCGGCCTTCCCGATGGGCGTCAACGTCAACCGCAGCCACAAGCTCTACAGCTGGGGCACCCAGA
TCCGCGGCGTCGAGACCGGCGGCTCGGTCATCAACCTGCCCGTCCACACCTTCCCGACCGACGACGGTTC
GGTGGCGATGAAATGCCCCACCGAGATCGCCATCGACGACCGGCGCGAGGCGGAACTCGCCAGACTCGGG
ATGATGCCGATCCTGCACCGCAAGAACACCGACATTGCGGCCTTCATCGGCGCTCACAGCCTGCAGGACG
ACGAGGCCCGCGCCGGACGGCTGGTCGATCCCGACGCGCAGTCGAACGAGCGGCTGAGCGCGAACCTGCC
CTACCTCTTCCCCGTCTGCCGCTTCGCCCATTACCTCAAGGCCATCGCGCGCGACAAGATCGGCAGCTTC
AAGGAACGGGCCGACATGCAGGTCTGGCTATCCGAGTGGATCAACCGCTATGTCCTCGCCAACACCGCCA
TGGCCGATGACAAGCAGAAGGCGCGCCGCCCGCTCGCCGCCGCCGAGGTGCAGGTCGACAGCGTCGAGGG
CCGCCCCGGCTACTATGCCGCGCGCTTCTACCTGCGGCCGCACTACCAGCTCGAGGGCATCAACGCGAGC
CTGCGGCTCGTCTCGGAACTGCCCTCCGTCAAGGGAGGCTGA