SecReT6
Protein ID: 126463882
SecReT6 ID177
T6SS typei3
Gene symbol-
Locus tagRsph17029_3123
StrainRhodobacter sphaeroides ATCC 17029
Repliconchromosome II [GenBank: NC_009050] [Browse all T6SS(s) in this replicon]
Location [Strand]139323..139814 [+]
Producthypothetical protein
NoteTssD
UniProt IDA3PPF7
KEGG IDrsh:Rsph17029_3123
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 9.10E-36, Aligned region: 6..140
Protein Sequence: 163 a.a.     [Download]
>gi|126463882|ref|YP_001044995.1| hypothetical protein Rsph17029_3123 [Rhodobacter sphaeroides ATCC 17029]
MAFTGYLKIEDIKGESRRADHEDEIDAFGVSWLVEQTSSASTGSGRTRGRARVGDFRLRKWMDASSPYLA
LACMQGKSFPEMIFMARKDSGEAHLDYLQVTLKNCIVSSYALAQDAPEESGHDMIAEDVAISFETITYKY
VVQADDHSAGDEHEVEYNVVAAR
 
Nucleotide Sequence: 492 bp     [Download]
>gi|126463752|ref|NC_009050.1|:139323-139814 Rhodobacter sphaeroides ATCC 17029 chromosome 2, complete sequence
ATGGCATTCACAGGCTACCTCAAGATCGAGGACATCAAGGGCGAGTCGCGGCGCGCCGACCACGAGGACG
AGATCGACGCCTTCGGCGTGAGCTGGCTCGTCGAGCAGACGAGCTCGGCCTCGACCGGCAGCGGCCGGAC
GCGCGGCCGCGCCAGGGTGGGCGACTTCCGGCTGCGCAAATGGATGGACGCCTCTTCGCCCTATCTCGCG
CTGGCCTGCATGCAGGGCAAGTCCTTCCCCGAGATGATCTTCATGGCCCGCAAGGACTCCGGCGAGGCGC
ATCTCGATTATCTGCAGGTGACGCTGAAGAACTGCATCGTCTCGAGCTATGCGCTCGCGCAGGATGCGCC
CGAGGAGTCGGGCCATGACATGATCGCCGAGGATGTGGCGATCTCGTTCGAGACCATCACCTACAAATAT
GTCGTTCAGGCCGACGACCATTCGGCCGGCGACGAGCACGAGGTCGAATATAACGTCGTCGCCGCCCGCT
GA