SecReT6
Protein ID: 126463884
SecReT6 ID177
T6SS typei3
Gene symbol-
Locus tagRsph17029_3125
StrainRhodobacter sphaeroides ATCC 17029
Repliconchromosome II [GenBank: NC_009050] [Browse all T6SS(s) in this replicon]
Location [Strand]140554..142419 [+]
Producthypothetical protein
NoteTssF
UniProt IDA3PPF9
KEGG IDrsh:Rsph17029_3125
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 5.40E-163, Aligned region: 5..620
Protein Sequence: 621 a.a.     [Download]
>gi|126463884|ref|YP_001044997.1| hypothetical protein Rsph17029_3125 [Rhodobacter sphaeroides ATCC 17029]
MDRAFLAYYEAELAELREAAAAFGTLHPTVGRNLSLDTVPCPDPYVERLLEGVAWLAARTRLKLDAEAQR
SVRNLLDWLWPDLAGPAPAMALATLHPGPQVLGMADGHTVTRGTRLVAAFREGLATRATYTTAQDVTLWP
VALEAAGYLPDRGALKAAGLSEAMAGSAEAAIHLALARAGPGTLSELSLDRLDLCFAGSPRAPALFDAIH
GTCRRAAARGAADFGRVPAPTLVGIDGAEGLLPRLRPSFEGYRLIREYFLMPDRFHYLRLDGLQTAIRAA
TGRVEILLLLDRPRPALADLAASDFRLFVTPVVNLFEKECNAVEVDPRSAAHVVHPDRTRPRDFEILRLL
RVEDADSSGPEAVIEPLHAPAAQGGSGLFYTTERRPRRPGEDELRRGQTRTSHAGDDLCISLVRRPGATA
PAVRRLDIRALCTNRDLPILDDSPRLTLESGDPVARVELLSALRRPRPALAAGLPRMTREAEAQQDEVIW
RLAAQLALDHLSLAETTDDAEPLRALLALYADRGDPAVARHARSIARVRARAVTERLDLPGPLCFGRGQE
VTLEVDETVLSGASTLLLSALLAQLFARQAAINAVVRLRTRLVQAQEEVTWPTIPGIRPPI
 
Nucleotide Sequence: 1866 bp     [Download]
>gi|126463752|ref|NC_009050.1|:140554-142419 Rhodobacter sphaeroides ATCC 17029 chromosome 2, complete sequence
ATGGACCGCGCCTTCCTCGCCTATTACGAGGCCGAACTGGCCGAGCTGCGCGAGGCGGCGGCCGCGTTCG
GCACCCTGCATCCGACGGTGGGGCGCAACCTCTCGCTCGATACGGTGCCCTGCCCGGACCCCTATGTGGA
ACGGCTGCTCGAGGGGGTGGCCTGGCTCGCGGCAAGGACCCGGCTCAAGCTCGACGCCGAGGCGCAGCGC
AGCGTGCGCAACCTGCTCGACTGGCTCTGGCCCGACCTCGCCGGGCCCGCGCCGGCCATGGCGCTCGCCA
CCCTTCACCCGGGGCCGCAGGTGCTGGGGATGGCGGACGGCCACACGGTGACGCGCGGCACCCGCCTCGT
CGCGGCCTTCCGCGAGGGGCTGGCCACGCGCGCCACCTACACGACCGCGCAGGACGTCACCCTCTGGCCG
GTGGCGCTTGAGGCGGCAGGCTACCTGCCCGACCGCGGCGCCTTGAAGGCCGCGGGGCTCTCCGAGGCGA
TGGCGGGGAGCGCCGAGGCGGCCATCCACCTCGCCCTCGCGCGCGCAGGGCCGGGCACGCTCTCCGAGCT
GTCGCTCGACCGGCTCGACCTGTGTTTCGCGGGCAGTCCGCGCGCGCCCGCGCTGTTCGACGCGATCCAC
GGCACCTGTCGACGGGCGGCGGCCCGCGGCGCGGCGGATTTCGGGCGGGTGCCGGCCCCTACCCTTGTCG
GCATCGACGGGGCGGAGGGCCTGCTGCCGCGCCTGCGCCCCTCCTTCGAGGGCTACCGCCTCATCCGCGA
ATATTTCCTGATGCCGGATCGGTTCCACTACCTGCGCCTCGACGGGCTGCAGACAGCCATCCGCGCGGCG
ACGGGACGGGTCGAGATCCTGTTGCTCCTCGACCGTCCGCGGCCGGCGCTGGCGGACCTTGCGGCCTCGG
ACTTCCGGCTGTTCGTGACGCCCGTGGTCAATCTCTTCGAGAAGGAATGCAACGCGGTCGAAGTCGATCC
CCGCTCGGCCGCGCATGTCGTGCACCCGGACCGGACAAGGCCGCGCGACTTCGAGATCCTGCGCCTGCTG
CGGGTCGAGGATGCCGACAGCTCCGGCCCCGAGGCGGTGATCGAGCCCCTGCATGCGCCCGCGGCGCAAG
GGGGCTCGGGCCTCTTCTACACCACCGAGCGCCGCCCCCGCCGCCCCGGCGAGGACGAGCTGCGCCGGGG
CCAGACCCGCACGAGCCACGCGGGCGACGATCTCTGCATTTCGCTCGTGCGGCGTCCGGGCGCGACGGCG
CCTGCCGTGCGGCGGCTCGACATCCGCGCGCTCTGCACCAACCGCGACCTGCCGATCCTGGACGACAGCC
CGCGCCTCACGCTCGAAAGCGGCGATCCGGTGGCGCGGGTCGAGCTTCTGTCGGCACTCCGCCGCCCCCG
TCCCGCGCTGGCCGCCGGGCTGCCGCGCATGACCCGCGAAGCGGAGGCGCAGCAGGACGAGGTCATCTGG
CGCCTCGCCGCGCAGCTCGCGCTCGATCATCTGTCGCTCGCCGAGACGACCGACGACGCCGAACCGCTGC
GTGCGCTGCTCGCCCTCTATGCCGACCGAGGCGACCCGGCGGTGGCCCGCCATGCGCGCTCCATCGCCCG
GGTGCGGGCGCGCGCCGTGACCGAGCGGCTGGATCTGCCCGGCCCGCTCTGCTTCGGCCGCGGACAGGAG
GTGACGCTCGAAGTCGACGAGACGGTGCTGAGCGGGGCGAGCACGCTTCTTCTGTCCGCGTTGCTGGCGC
AGCTCTTCGCGCGGCAGGCGGCGATCAACGCGGTCGTCCGGCTGCGCACGCGGCTGGTTCAGGCACAGGA
GGAGGTGACATGGCCGACGATCCCCGGCATCCGCCCCCCGATCTGA