SecReT6
Protein ID: 126463885
SecReT6 ID177
T6SS typei3
Gene symbol-
Locus tagRsph17029_3126
StrainRhodobacter sphaeroides ATCC 17029
Repliconchromosome II [GenBank: NC_009050] [Browse all T6SS(s) in this replicon]
Location [Strand]142383..143381 [+]
Producthypothetical protein
NoteTssG
UniProt IDA3PPG0
KEGG IDrsh:Rsph17029_3126
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 4.30E-68, Aligned region: 16..308
Protein Sequence: 332 a.a.     [Download]
>gi|126463885|ref|YP_001044998.1| hypothetical protein Rsph17029_3126 [Rhodobacter sphaeroides ATCC 17029]
MADDPRHPPPDLSPATGFFELLRRLEAPELRFGRTGPEPARLGQRVRLSMAARDVAALRPGAPPFVEVEV
LGLLGPEGPMPLHLTRWMMQRLSDRWFEGTDGGTADTTALDFLNMIQHRLLALYWRAWGDQRPEVQAAFG
TGRLGAMIDALAGLGLPGPRPARLDGVKRRHATSLASGIQSPARLTDLVACHLGAPTTLREFLPHWMPIP
LPLQSRLGRQHARLGRGAVAGARSFQRQTRAELRVGPVDLPLYLRLIEDPALAADLRHLVGVAAPREVTV
GLRPLLRRAAIPAPRLGSVRLGRTLWLAGGRHRDAEDWRRPSLLPAEGEAGC
 
Nucleotide Sequence: 999 bp     [Download]
>gi|126463752|ref|NC_009050.1|:142383-143381 Rhodobacter sphaeroides ATCC 17029 chromosome 2, complete sequence
ATGGCCGACGATCCCCGGCATCCGCCCCCCGATCTGAGCCCCGCCACGGGCTTCTTCGAGCTGCTGCGCC
GGCTGGAGGCGCCGGAGCTCCGCTTCGGGCGCACCGGCCCCGAGCCCGCGCGGCTCGGCCAGCGCGTGCG
GCTGTCGATGGCGGCGCGCGACGTGGCGGCGCTGCGCCCCGGCGCGCCGCCCTTCGTCGAGGTCGAGGTG
CTGGGCCTTCTCGGCCCCGAGGGGCCGATGCCCCTGCATCTCACGCGCTGGATGATGCAGCGCCTGTCCG
ACCGCTGGTTCGAGGGCACCGACGGCGGGACTGCCGATACGACGGCGCTCGATTTCCTCAACATGATCCA
GCACCGGCTGCTCGCGCTCTACTGGCGCGCCTGGGGCGACCAGAGGCCCGAGGTGCAGGCAGCCTTCGGC
ACGGGGCGGCTCGGGGCCATGATCGACGCCCTCGCCGGTCTGGGCCTGCCCGGGCCGCGGCCCGCCCGCC
TCGACGGGGTGAAGCGGCGGCACGCGACCTCGCTGGCCTCCGGGATCCAGAGCCCCGCCCGGCTGACGGA
TCTGGTGGCCTGCCATCTCGGCGCGCCAACCACGCTTCGTGAATTTCTGCCGCACTGGATGCCGATCCCG
CTGCCGCTGCAGAGCCGGCTCGGCCGCCAGCACGCCCGCCTCGGCCGCGGCGCGGTGGCCGGGGCGCGCA
GCTTCCAGCGCCAGACCCGGGCCGAGCTGCGCGTGGGGCCGGTGGATCTGCCGCTCTACCTGCGCCTGAT
CGAGGATCCGGCGCTCGCGGCCGACCTGCGCCATCTGGTGGGCGTGGCCGCCCCGCGCGAGGTGACGGTG
GGGCTGCGGCCCCTCCTGCGGCGCGCGGCGATCCCCGCCCCGCGCCTCGGCTCGGTGCGGCTCGGACGGA
CGCTCTGGCTGGCGGGCGGCCGCCACCGCGACGCCGAAGACTGGCGGCGGCCAAGCCTTCTTCCCGCAGA
GGGAGAGGCCGGATGCTGA