SecReT6
Protein ID: 126463886
SecReT6 ID177
T6SS typei3
Gene symbol-
Locus tagRsph17029_3127
StrainRhodobacter sphaeroides ATCC 17029
Repliconchromosome II [GenBank: NC_009050] [Browse all T6SS(s) in this replicon]
Location [Strand]143375..144604 [+]
ProductFHA domain-containing protein
NoteFha
UniProt IDA3PPG1
KEGG IDrsh:Rsph17029_3127
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 3.80E-13, Aligned region: 26..94
Protein Sequence: 409 a.a.     [Download]
>gi|126463886|ref|YP_001044999.1| FHA domain-containing protein [Rhodobacter sphaeroides ATCC 17029]
MLRLVIEHAPCPQRVGEMRLEAGELSIGRSADCDWQIDDPDMFVSRRHCIVSGGEGGWRVIDASRGGLFL
DGSENPLGAGNSAVLAQGTRLRLGDVVLRAEIEGREPLRAPPAPREAALAVDDFFASPRAVTPEPPPRPK
DLPGPFEAVERAPAPPPQDDFGFGWALPAGSRPAPAEARATEGQDPFFRPGTATGTPSPEGSPAPPQAMS
APRELALSEDALSEAFFRGLGLPSETLDAAAMEAMGRRFRLLAEGLVLLLRARAREKGAARVPQSVIGAS
EVNPLKFLVTLDEAVAALVTPRGPGYLGPEASIEGAFRDLTDHQLRNWIAVQAALRRMIDRFDPARFEAE
SEREGRMAQLLAGGRSARLWQLYLDRYEELARAAEDRFLGEVGADFREAYEGPERRENG
 
Nucleotide Sequence: 1230 bp     [Download]
>gi|126463752|ref|NC_009050.1|:143375-144604 Rhodobacter sphaeroides ATCC 17029 chromosome 2, complete sequence
ATGCTGAGGCTCGTCATCGAACATGCGCCCTGCCCGCAGCGCGTGGGCGAGATGCGGCTCGAAGCGGGCG
AACTCTCGATCGGGCGCAGTGCCGACTGCGACTGGCAGATCGACGACCCGGACATGTTCGTCTCGCGCAG
GCACTGCATCGTCTCGGGCGGCGAGGGCGGCTGGCGGGTGATCGACGCAAGCCGGGGCGGGCTGTTCCTC
GACGGATCCGAGAACCCGCTCGGCGCAGGAAACTCCGCGGTGCTGGCGCAGGGCACCCGGCTCCGGCTGG
GCGATGTCGTGCTGCGGGCCGAGATCGAGGGGCGCGAGCCCCTGCGCGCGCCGCCCGCCCCGCGCGAGGC
GGCACTGGCGGTCGACGATTTCTTCGCGTCGCCGCGCGCAGTGACGCCCGAGCCTCCGCCGCGGCCGAAG
GATCTGCCGGGACCGTTCGAGGCGGTGGAGCGGGCGCCCGCCCCGCCGCCGCAGGATGACTTCGGCTTCG
GGTGGGCCCTGCCCGCGGGGTCCCGCCCCGCCCCCGCCGAGGCGCGTGCCACGGAAGGACAGGACCCGTT
CTTCAGGCCGGGCACAGCGACGGGGACCCCTTCCCCGGAAGGATCCCCGGCCCCGCCGCAGGCGATGTCC
GCGCCAAGGGAGCTCGCCTTGTCGGAGGACGCCCTGTCCGAGGCCTTCTTCCGCGGCCTGGGCCTTCCGT
CCGAGACCCTCGACGCAGCGGCGATGGAGGCGATGGGCCGCCGCTTCCGGCTGCTGGCCGAGGGGCTCGT
CCTCCTGCTGCGCGCCCGCGCCCGCGAGAAGGGCGCCGCCCGCGTGCCGCAGAGCGTGATCGGGGCCTCG
GAGGTGAACCCGCTGAAATTCCTCGTCACGCTCGACGAGGCGGTGGCCGCGCTGGTGACGCCGCGGGGGC
CGGGATATCTCGGCCCCGAGGCTTCCATCGAGGGCGCCTTCCGCGACCTGACCGATCATCAGCTGCGCAA
CTGGATCGCGGTGCAGGCCGCGCTGCGCCGGATGATCGACCGGTTCGATCCCGCGCGCTTCGAGGCCGAG
AGCGAGCGCGAGGGCCGGATGGCGCAGCTCCTTGCCGGCGGCCGCAGCGCGCGGCTCTGGCAGCTGTATC
TCGACCGTTACGAAGAGCTCGCCCGCGCGGCCGAGGACCGGTTCCTCGGCGAGGTCGGGGCCGATTTCAG
GGAGGCCTACGAGGGCCCGGAGAGGAGAGAGAATGGCTGA