SecReT6
Protein ID: 126463887
SecReT6 ID177
T6SS typei3
Gene symbol-
Locus tagRsph17029_3128
StrainRhodobacter sphaeroides ATCC 17029
Repliconchromosome II [GenBank: NC_009050] [Browse all T6SS(s) in this replicon]
Location [Strand]144597..145049 [+]
Producthypothetical protein
NoteTssJ
UniProt IDA3PPG2
KEGG IDrsh:Rsph17029_3128
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.80E-24, Aligned region: 15..143
Protein Sequence: 150 a.a.     [Download]
>gi|126463887|ref|YP_001045000.1| hypothetical protein Rsph17029_3128 [Rhodobacter sphaeroides ATCC 17029]
MADRRMFLAGAGALLLVAGCGGPKAGTLTVSATGTAGMNPGPDGSDRPLTIQILQLRGTAAFDAADAFAL
QSPATSLGADLLKADLVTLMPGAPVVRAIPLDPSVAAVGVVAGFRSAGGRSYRYSFSVAPTAEVALKIDV
GQGGLVVVQG
 
Nucleotide Sequence: 453 bp     [Download]
>gi|126463752|ref|NC_009050.1|:144597-145049 Rhodobacter sphaeroides ATCC 17029 chromosome 2, complete sequence
ATGGCTGACAGACGCATGTTCCTTGCGGGCGCGGGGGCGCTTTTGCTCGTGGCGGGCTGCGGGGGGCCCA
AGGCCGGCACGCTCACCGTCAGTGCCACGGGCACGGCCGGCATGAACCCCGGCCCCGACGGGAGCGACCG
GCCGCTGACGATCCAGATCCTGCAGCTGCGCGGCACCGCGGCCTTCGACGCGGCCGACGCCTTCGCGCTC
CAGTCGCCGGCGACGAGCCTCGGCGCGGACCTGCTCAAGGCGGATCTCGTGACGCTGATGCCGGGCGCGC
CGGTCGTGCGGGCGATCCCGCTCGACCCGTCGGTGGCGGCCGTCGGCGTGGTCGCGGGCTTCCGCAGCGC
GGGCGGACGCAGCTACCGCTACAGCTTCAGCGTCGCGCCCACCGCCGAGGTGGCGCTGAAGATCGACGTG
GGCCAGGGGGGCCTCGTCGTGGTGCAGGGCTGA