SecReT6
Protein ID: 126463888
SecReT6 ID177
T6SS typei3
Gene symbol-
Locus tagRsph17029_3129
StrainRhodobacter sphaeroides ATCC 17029
Repliconchromosome II [GenBank: NC_009050] [Browse all T6SS(s) in this replicon]
Location [Strand]145058..146386 [+]
Producthypothetical protein
NoteTssK
UniProt IDA3PPG3
KEGG IDrsh:Rsph17029_3129
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.30E-116, Aligned region: 18..440
Protein Sequence: 442 a.a.     [Download]
>gi|126463888|ref|YP_001045001.1| hypothetical protein Rsph17029_3129 [Rhodobacter sphaeroides ATCC 17029]
MSGNRVVWSEGLFLRTQHFQQQDRHAEALLRAALLAAPWQPFGFTRLALDAAALDAGRVALAEAEALMPD
GTAFRLAEAEPPPAAALRRDGPPGLVQLALPLEQEGAASVDPAHAAPSGARYRGRIEVLRDAIRGGAEPE
EVELARLAPRLIAPGEPADGCVTLPVARVEGLRADGSVALQEGWLPPALTIGAVPWYGALLQELVTGLDR
VADAHGGLVLGGAGRSIENLLILELANTARPRLAHLLQQAQEHPSALYAELAALAGRMATYGSSSRRLSA
LAPYDHLEPQPAFAALADTLRSLLLSLRHVEPKSRALPVARHAQNIWKVRIDNPEILRSSRIVLRVGSEM
SDESLRRLFADQATVGAADAFERLWTSRLPGIPLKPLHSQPREIPYDGERLCLELDQKSEHWSQLLEAPG
FVVGVSGVLEREPQIDCYAVSR
 
Nucleotide Sequence: 1329 bp     [Download]
>gi|126463752|ref|NC_009050.1|:145058-146386 Rhodobacter sphaeroides ATCC 17029 chromosome 2, complete sequence
ATGAGCGGCAACAGGGTGGTCTGGTCGGAAGGGCTCTTCCTCAGGACCCAGCACTTCCAGCAGCAGGACC
GGCACGCCGAGGCGCTGTTGCGCGCGGCGCTTCTTGCGGCGCCCTGGCAGCCCTTCGGCTTCACGAGGCT
CGCGCTCGATGCGGCGGCGCTCGACGCAGGCCGCGTGGCGCTCGCCGAGGCGGAGGCGCTGATGCCGGAC
GGCACGGCCTTCCGCCTGGCCGAGGCCGAGCCGCCGCCGGCCGCGGCGCTCCGCCGCGACGGGCCGCCGG
GCCTCGTCCAGCTGGCGCTGCCGCTCGAACAGGAGGGGGCGGCGAGTGTCGATCCCGCCCATGCCGCACC
TTCGGGGGCGCGCTACCGCGGGCGGATCGAGGTGCTGCGCGATGCGATCCGCGGCGGCGCCGAGCCCGAG
GAGGTGGAGCTCGCGCGGCTCGCCCCGCGCCTGATCGCGCCGGGAGAGCCCGCGGACGGCTGCGTGACGC
TGCCCGTGGCGCGCGTCGAGGGGCTGCGCGCGGACGGATCGGTGGCCCTGCAGGAGGGATGGCTGCCCCC
TGCCCTCACCATCGGCGCCGTGCCGTGGTATGGCGCGCTGCTTCAGGAGCTGGTGACGGGGCTCGACCGG
GTGGCCGATGCCCATGGCGGGCTCGTGCTGGGCGGCGCCGGGCGCTCGATCGAGAACCTGCTGATCCTCG
AACTGGCCAACACCGCGCGCCCGCGCCTCGCCCACCTGCTCCAGCAGGCGCAGGAACATCCCTCGGCGCT
CTATGCCGAGCTGGCCGCGCTCGCCGGGCGGATGGCGACCTACGGCTCCTCCTCGCGCCGGCTGAGCGCG
CTTGCGCCCTACGACCATCTCGAGCCGCAACCGGCCTTCGCGGCTCTGGCCGACACGCTGCGTTCGCTTC
TTCTGTCGCTGCGCCATGTCGAGCCGAAGTCGCGCGCGCTGCCGGTGGCGCGCCATGCGCAGAACATCTG
GAAGGTCCGCATCGACAATCCCGAGATCCTGCGCTCCTCGCGCATCGTGCTGCGCGTGGGCTCGGAGATG
TCGGACGAGAGCCTGCGCCGGCTCTTCGCCGATCAGGCGACGGTGGGCGCGGCCGATGCCTTCGAGCGGC
TCTGGACCTCGCGCCTGCCGGGCATCCCGCTGAAGCCGCTCCATTCCCAGCCGCGCGAGATCCCCTACGA
CGGCGAGCGGCTCTGCCTCGAGCTCGATCAGAAATCCGAGCACTGGTCGCAGTTGCTCGAGGCGCCGGGC
TTCGTGGTGGGGGTTTCGGGCGTGCTCGAGCGCGAGCCGCAGATCGATTGCTATGCGGTGAGCCGATGA