SecReT6
Protein ID: 126463889
SecReT6 ID177
T6SS typei3
Gene symbol-
Locus tagRsph17029_3130
StrainRhodobacter sphaeroides ATCC 17029
Repliconchromosome II [GenBank: NC_009050] [Browse all T6SS(s) in this replicon]
Location [Strand]146451..147812 [+]
ProductOmpA/MotB domain-containing protein
NoteTssL
UniProt IDA3PPG4
KEGG IDrsh:Rsph17029_3130
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.60E-53, Aligned region: 55..260
OmpA [PF00691], Evalue: 9.00E-15, Aligned region: 341..443
Protein Sequence: 453 a.a.     [Download]
>gi|126463889|ref|YP_001045002.1| OmpA/MotB domain-containing protein [Rhodobacter sphaeroides ATCC 17029]
MTREDDPFGLATDAARTRIRPSPAERARRAAAGPAPAEVGAVAPVRPAHGRTHPNPLVASFAVLLELAPA
LEGAAPPQEPGMLRARLRDGLTEARDRSVAQGVPLARADRAAWFVAALLDDLALNTPWGAASGWPRQPLV
TELSGEVDAGTRFFDRLEELARHPTLDPQLLELVWLCLSLGFRGKHRTGREGGESALFALRTGVARLLRN
PEATAAPLSPHWEGVAAPDAPRRFAVPVWTVGLAALALMAALYTGLSLQLSARAEKLFDLAALVPPAERA
ALFRPPRETVAPPPEIRVEPVVIELLPAFRARAPAATAAALQGREDAQLTILTLQGTDPELFRSARAEVN
PDYAPLVASVAAVLAENRELVGAVRVIGHTDNVPVQRSNPFASNQGLSEARAATLAALLVEGGVPAGIVT
AEGHADTEPVADNATRAGRAQNRRVEIRIEKRL
 
Nucleotide Sequence: 1362 bp     [Download]
>gi|126463752|ref|NC_009050.1|:146451-147812 Rhodobacter sphaeroides ATCC 17029 chromosome 2, complete sequence
ATGACGCGGGAGGACGATCCGTTCGGTCTGGCGACCGATGCCGCCCGCACCCGGATCAGGCCCTCTCCTG
CCGAACGGGCGCGCCGGGCCGCGGCCGGGCCCGCTCCGGCCGAGGTGGGCGCCGTGGCCCCGGTCCGCCC
GGCCCACGGGAGGACCCATCCCAATCCGCTCGTCGCGAGCTTCGCCGTCCTGCTCGAACTCGCGCCTGCG
CTGGAAGGCGCCGCCCCGCCGCAGGAGCCGGGGATGCTGCGCGCGCGGCTCCGCGACGGTCTGACCGAGG
CCCGCGACCGGAGCGTGGCGCAGGGCGTGCCGCTGGCCCGCGCCGACCGCGCCGCGTGGTTCGTGGCAGC
GCTCCTCGACGATCTGGCCTTGAACACGCCCTGGGGTGCGGCCAGCGGATGGCCGCGCCAGCCGCTCGTG
ACCGAGCTGTCGGGCGAGGTCGATGCGGGCACCCGCTTCTTCGACCGCCTCGAAGAGCTCGCGCGCCATC
CGACGCTCGACCCGCAGCTTCTGGAGCTGGTCTGGCTCTGCCTGTCGCTCGGCTTTCGCGGCAAGCACCG
CACGGGGCGCGAGGGCGGCGAGAGCGCGCTCTTCGCGCTCCGCACCGGCGTGGCGCGCCTTCTGCGCAAT
CCGGAGGCTACGGCCGCGCCGCTCTCGCCGCACTGGGAGGGGGTCGCGGCGCCCGACGCGCCGCGCCGCT
TCGCGGTGCCGGTCTGGACGGTGGGACTCGCGGCGCTTGCGCTGATGGCCGCCCTCTACACGGGCCTCTC
GCTCCAGCTGTCGGCGCGGGCCGAGAAGCTCTTCGATCTGGCAGCCCTCGTGCCCCCGGCCGAGCGCGCG
GCCCTGTTCCGCCCCCCGCGCGAGACGGTCGCGCCGCCGCCCGAGATCCGGGTGGAGCCGGTGGTGATCG
AGCTTCTGCCCGCCTTCCGGGCCCGCGCCCCCGCCGCCACCGCGGCCGCCCTTCAGGGCCGCGAGGATGC
GCAGCTCACCATCCTCACGCTGCAGGGCACGGACCCCGAGCTGTTCCGCTCGGCCCGCGCCGAGGTGAAC
CCGGACTATGCGCCGCTGGTGGCCTCGGTCGCGGCCGTCCTCGCCGAGAACCGCGAGCTGGTGGGGGCAG
TCCGTGTCATCGGCCATACCGATAACGTGCCGGTCCAGCGCAGCAATCCCTTCGCCTCGAACCAGGGCCT
GTCCGAGGCCCGCGCCGCCACTCTCGCGGCCCTCCTCGTCGAGGGCGGCGTGCCCGCGGGGATCGTCACC
GCCGAAGGCCATGCCGACACCGAGCCGGTCGCCGACAATGCCACGCGCGCGGGCCGGGCGCAGAACCGCC
GCGTCGAGATCCGCATCGAGAAGAGGCTCTAA