SecReT6
Protein ID: 126463892
SecReT6 ID177
T6SS typei3
Gene symbol-
Locus tagRsph17029_3133
StrainRhodobacter sphaeroides ATCC 17029
Repliconchromosome II [GenBank: NC_009050] [Browse all T6SS(s) in this replicon]
Location [Strand]151824..154127 [-]
ProductRhs element Vgr protein
NoteTssI
UniProt IDA3PPG7
KEGG IDrsh:Rsph17029_3133
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.60E-77, Aligned region: 27..325
Phage_GPD [PF05954], Evalue: 2.60E-77, Aligned region: 572..617
Phage_base_V [PF04717], Evalue: 1.30E-24, Aligned region: 200..217
Phage_base_V [PF04717], Evalue: 1.30E-24, Aligned region: 365..457
Gp5_C [PF06715], Evalue: 1.00E-16, Aligned region: 500..521
Gp5_C [PF06715], Evalue: 1.00E-16, Aligned region: 531..554
Gp5_C [PF06715], Evalue: 1.00E-16, Aligned region: 556..577
Gp5_C [PF06715], Evalue: 1.00E-16, Aligned region: 580..594
Gp5_C [PF06715], Evalue: 1.00E-16, Aligned region: 598..618
Gp5_C [PF06715], Evalue: 1.00E-16, Aligned region: 624..642
Gp5_C [PF06715], Evalue: 1.00E-16, Aligned region: 644..666
Gp5_C [PF06715], Evalue: 1.00E-16, Aligned region: 676..692
Protein Sequence: 767 a.a.     [Download]
>gi|126463892|ref|YP_001045005.1| Rhs element Vgr protein [Rhodobacter sphaeroides ATCC 17029]
MSEAREITLSLPAAAEDLWFSALEGEDGLGRPFHYELLLASKSLDLAAADILGTPVLVTVRGEVPRHFHG
IATAFGLDEIRDDHAHYRLTMEPSMALLGLRRDNRIFQDRSVPEILEAVLSEIPGLDWDFRLQASYPPRD
YCVQYGETDLDFVQRLMEHEGIGYFFEHGAEGHRLVLFDTNARLAPAPGAEILPYEPDSRVSFRDGDFIT
AWLPRAHIRPGKVSQGDYDFEKPSSDLTSRAENPLGHAADDAEHYRWPGDYRTLPAGDRLSRLRLEEAQA
LQVRIEARGTARPLWPGRIFRLDLFPREAENDDYLVTACRYRLWDDQFRSGQSRAEVGYEVDLSLVPARV
PYRPERRTPRPVMKGPQTALVVGPAGAEIFTDRYARVKVHFFWDRLDARNEASSCFVRVSQTWAGAGWGF
IQIPRIGQEVIVDFIEGDPDRPIVTGRVYNAEQMPPYGLPGQATQSGWKSHSSPGGGGWNELRFEDKAGA
EEVYFQAQKDHTELIKNDESRTIGHDFAEDVGHDAVQSVAHDRRESVGNDKDTSVGRNRTVSIGVDDSES
VGANRALRVGADETIAVARNATETIGMNHTQTVGIAQTVTVGAARTDSVGGAETRSVGAVQTNTIAASRS
VSVGAGQTHSVGADDGWTVGGSQTVSVGADQSVTVGAKQTVSTGSDQVTTVGGSRATQVAKDDLQKADGA
MGIGVGKSYTLDVKDEITLKCGSAEITLKKDGTIVLKGKDITLDTSGKINLKAGGEITCKGSKINLN
 
Nucleotide Sequence: 2304 bp     [Download]
>gi|126463752|ref|NC_009050.1|:c154127-151824 Rhodobacter sphaeroides ATCC 17029 chromosome 2, complete sequence
ATGTCCGAGGCCCGCGAAATCACCCTGTCCCTCCCCGCTGCGGCCGAGGATCTATGGTTCTCGGCGCTCG
AGGGCGAGGACGGGCTGGGGCGCCCGTTCCACTACGAGTTGCTCCTCGCCAGCAAGTCGCTCGATCTCGC
CGCGGCCGACATCCTCGGCACGCCGGTGCTGGTGACGGTGCGGGGCGAGGTGCCGCGCCATTTCCACGGC
ATTGCCACCGCCTTCGGGCTCGACGAGATCCGCGACGACCATGCCCACTACCGGCTGACGATGGAGCCCT
CCATGGCGCTCCTCGGGCTGCGGCGCGACAACCGGATCTTTCAGGACCGGTCGGTGCCCGAGATCCTCGA
GGCCGTCCTGAGCGAGATCCCCGGTCTCGACTGGGATTTCAGGCTGCAGGCCAGCTATCCGCCGCGCGAC
TACTGCGTGCAGTATGGCGAGACCGATCTCGATTTCGTGCAGCGGCTGATGGAGCATGAGGGGATCGGCT
ATTTCTTCGAGCATGGCGCGGAGGGCCACAGGCTCGTCCTCTTCGACACGAATGCCCGGCTCGCGCCTGC
ACCGGGGGCCGAGATCCTGCCCTACGAGCCCGACAGCCGGGTGAGCTTCCGCGACGGCGATTTCATCACC
GCCTGGTTGCCCCGGGCGCATATCCGGCCGGGGAAGGTCTCGCAGGGCGACTACGATTTCGAGAAGCCCT
CGTCGGACCTGACGAGCCGCGCCGAAAATCCGCTCGGCCATGCGGCCGACGATGCCGAGCACTATCGCTG
GCCCGGGGATTACCGCACCCTTCCCGCGGGCGACCGGCTGTCCCGGCTCCGGCTCGAGGAGGCGCAGGCC
CTGCAGGTGCGCATCGAGGCCCGCGGCACCGCGCGGCCGCTCTGGCCGGGCCGGATCTTCCGGCTCGATC
TCTTCCCGCGCGAGGCGGAGAACGACGACTATCTCGTCACCGCCTGCCGCTACCGGCTCTGGGACGATCA
GTTCCGCTCGGGTCAGTCGCGCGCCGAGGTGGGCTACGAGGTGGATCTGTCGCTCGTCCCCGCCCGCGTC
CCCTACCGGCCCGAGCGGCGCACCCCGCGCCCGGTGATGAAGGGGCCGCAGACCGCCCTCGTGGTCGGGC
CAGCGGGCGCGGAGATCTTCACCGACAGATATGCGCGGGTGAAGGTGCATTTCTTCTGGGACCGGCTCGA
CGCCCGCAACGAGGCCTCCTCCTGCTTCGTCCGCGTGAGCCAGACCTGGGCCGGGGCCGGCTGGGGCTTC
ATCCAGATCCCCCGGATCGGGCAGGAGGTCATCGTCGATTTCATCGAGGGCGACCCCGACCGGCCCATCG
TCACGGGCCGGGTCTACAATGCCGAGCAGATGCCGCCCTACGGCCTGCCGGGCCAGGCCACCCAGTCGGG
CTGGAAGTCGCATTCCTCGCCCGGAGGCGGCGGCTGGAACGAGCTGCGCTTCGAGGACAAGGCCGGCGCG
GAGGAGGTCTATTTCCAGGCGCAGAAGGACCATACCGAGCTCATCAAGAACGACGAAAGCCGCACCATCG
GCCACGATTTCGCCGAGGATGTGGGCCATGACGCCGTGCAGTCCGTGGCGCACGACCGCCGGGAGAGCGT
GGGCAACGACAAGGACACGAGCGTGGGCCGGAACCGCACCGTCTCGATCGGCGTCGACGACAGCGAGAGC
GTGGGCGCGAACCGCGCGCTGCGGGTCGGCGCGGACGAGACGATCGCGGTGGCGCGGAATGCGACCGAGA
CCATCGGCATGAACCACACCCAGACGGTCGGCATCGCCCAGACGGTGACGGTCGGGGCGGCGCGCACCGA
CAGCGTCGGCGGGGCCGAGACGCGCTCGGTCGGCGCGGTCCAGACCAACACCATCGCCGCAAGCCGCAGC
GTTTCGGTCGGTGCGGGCCAGACCCATTCGGTGGGCGCCGACGACGGCTGGACCGTGGGCGGGTCGCAGA
CCGTCTCGGTCGGCGCGGACCAGTCGGTGACGGTGGGGGCGAAACAGACGGTCAGCACCGGCTCGGATCA
GGTGACCACCGTCGGCGGCTCCCGCGCCACGCAGGTGGCCAAGGACGACCTGCAGAAGGCCGATGGCGCC
ATGGGCATCGGCGTGGGCAAGAGCTACACGCTCGACGTCAAGGACGAGATCACCCTGAAATGCGGCTCGG
CCGAGATCACGCTGAAGAAGGACGGCACCATCGTCCTCAAGGGCAAGGACATCACGCTGGACACCTCGGG
CAAGATCAACCTCAAGGCGGGCGGCGAGATCACCTGCAAGGGCTCGAAGATCAACCTGAACTGA