SecReT6
Protein ID: 126463896
SecReT6 ID177
T6SS typei3
Gene symbol-
Locus tagRsph17029_3137
StrainRhodobacter sphaeroides ATCC 17029
Repliconchromosome II [GenBank: NC_009050] [Browse all T6SS(s) in this replicon]
Location [Strand]158302..159066 [+]
ProductOmpA/MotB domain-containing protein
NoteTagL
UniProt IDA3PPH1
KEGG IDrsh:Rsph17029_3137
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 2.70E-16, Aligned region: 152..246
Protein Sequence: 254 a.a.     [Download]
>gi|126463896|ref|YP_001045009.1| OmpA/MotB domain-containing protein [Rhodobacter sphaeroides ATCC 17029]
MARRATLTRRICALLLASLAAAPTGAGAEGLTDAELLGLFHRQRDAFAAARSGNGQARGLKLVTVDRIGP
APAVADVPDSLEAPAGEDPGLRPTASTDSAPGETGRPVLGLPQGADRLAAADPLPERRETAEVSPESFGL
LDPALQVNVRIHFSFDSAVLAADQTPLLAQLCTVMKASDIRLFQIVGHTDAAGSEAYNQQLSLLRAEEVR
RYLTGPCGIAPERLRAVGMGERFLADKKDPRSGENRRVEFQALS
 
Nucleotide Sequence: 765 bp     [Download]
>gi|126463752|ref|NC_009050.1|:158302-159066 Rhodobacter sphaeroides ATCC 17029 chromosome 2, complete sequence
ATGGCCCGCCGAGCGACCCTGACGCGCCGGATCTGCGCGCTTCTTCTGGCGAGCCTCGCCGCTGCCCCGA
CCGGGGCCGGCGCAGAGGGCCTGACCGATGCGGAGCTTCTCGGGCTTTTCCACCGGCAGCGCGACGCTTT
CGCGGCGGCCCGGAGCGGCAATGGTCAGGCGCGCGGACTGAAGCTCGTGACGGTGGACCGGATCGGGCCG
GCGCCCGCCGTGGCCGATGTGCCGGACAGCCTCGAGGCGCCCGCGGGCGAGGATCCCGGCCTTCGGCCGA
CGGCCTCGACCGACAGCGCGCCGGGCGAGACCGGGCGGCCGGTCCTCGGCCTGCCGCAGGGGGCCGACCG
GCTGGCCGCCGCGGATCCGCTGCCCGAGCGGCGTGAGACGGCGGAGGTCTCTCCTGAGAGCTTCGGCCTT
CTCGATCCGGCGCTGCAGGTCAATGTGCGCATCCATTTCTCCTTCGACTCCGCGGTGCTGGCCGCGGATC
AGACGCCGCTTCTCGCGCAGCTCTGCACGGTGATGAAGGCGAGCGACATCCGCCTGTTTCAGATCGTGGG
CCATACCGACGCGGCGGGCAGCGAGGCCTACAACCAGCAGCTCTCGCTCCTGCGGGCCGAGGAGGTGCGG
CGCTATCTGACCGGCCCCTGCGGCATCGCGCCGGAACGGCTGCGCGCCGTGGGGATGGGCGAGCGGTTCC
TGGCCGACAAGAAGGACCCCCGCAGCGGCGAGAACCGGCGGGTCGAGTTTCAGGCGCTGAGTTAG