SecReT6
Protein ID: 134293815
SecReT6 ID197
T6SS typeN/A
Gene symbol-
Locus tagBcep1808_5135
StrainBurkholderia vietnamiensis G4
Repliconchromosome II [GenBank: NC_009255] [Browse all T6SS(s) in this replicon]
Location [Strand]2043205..2043483 [-]
Producthypothetical protein
NotePAAR
UniProt IDA4JP83
KEGG IDbvi:Bcep1808_5135
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 1.70E-08, Aligned region: 7..51
PAAR_motif [PF05488], Evalue: 1.70E-08, Aligned region: 48..89
Protein Sequence: 92 a.a.     [Download]
>gi|134293815|ref|YP_001117551.1| hypothetical protein Bcep1808_5135 [Burkholderia vietnamiensis G4]
MHKMMALKGNATTTGGHVLDGDESDLDHGQPYAYHMGRASCGRCGQTGSIFGTAKTWGVGNTHGVLDGDI
VMCACPPGENRVIARSTSYYGE
 
Nucleotide Sequence: 279 bp     [Download]
>gi|134292031|ref|NC_009255.1|:c2043483-2043205 Burkholderia vietnamiensis G4 chromosome 2, complete sequence
ATGCACAAAATGATGGCGCTGAAAGGCAATGCAACGACAACGGGCGGTCACGTGCTCGATGGTGACGAGT
CCGATCTGGACCACGGACAACCCTATGCTTATCACATGGGCCGAGCGTCCTGCGGCCGTTGCGGCCAGAC
CGGGTCGATTTTCGGTACGGCGAAAACGTGGGGTGTAGGCAATACACACGGTGTACTCGACGGCGACATC
GTCATGTGCGCATGTCCGCCCGGCGAAAATCGCGTCATTGCCCGGTCGACGTCGTACTACGGCGAATAG